Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00793 FD00095 Serralysin P07268 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia unclassified Serratia Serratia marcescens (strain ATCC 21074 16 calcium ion binding, metalloendopeptidase activity, zinc ion binding 487 Extracellular metalloproteinase, Serratiopeptidase, Zinc proteinase None 617 extracellular matrix, extracellular space proteolysis 6396298 16 1:16 MQSTKKAIEITESNFA
PSQ00801 FND00291 Heat-stable enterotoxin A P07593 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia enterocolitica 34 toxin activity 71 YST-A ystA 630 extracellular space pathogenesis 4043080 34 20:53 QETVSGQFSDALSTPITAEVYKQACDPPLPPAEV
PSQ00802 FD00462 Fimbrial protein Q P07640 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Moraxella Moraxella bovis 6 None 157 Beta pilin, Q pilin tfpQ 476 pilus, type II protein secretion system complex cell adhesion, protein secretion by the type II secretion system 2902184 6 1:6 MNAQKG
PSQ00804 FD00108 Glutaryl-7-aminocephalosporanic-acid acylase P07662 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas sp 9 glutaryl-7-aminocephalosporanic-acid acylase activity 720 7-beta-(4-carboxybutanamido)cephalosporanic acid acylase, GL-7-ACA acylase None 269086 periplasmic space antibiotic biosynthetic process, response to antibiotic 2993240 9 190:198 DPPDLADQG
PSQ00808 FD00316 Photosystem II protein D1 1 P07826 Bacteria Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp 16 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, iron ion binding, oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor, oxygen evolving activity 360 Photosystem II Q(B) protein 1 psbA1 1111708 integral component of membrane, photosystem II, plasma membrane-derived thylakoid membrane photosynthetic electron transport in photosystem II, protein-chromophore linkage, response to herbicide 8034700 16 345:360 SGDAQMVALNAPAIEG
PSQ00810 FD00156 Penicillin G acylase P07941 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Kluyvera Kluyvera cryocrescens (Kluyvera citrophila) 54 metal ion binding, penicillin amidase activity 844 Penicillin G amidase, Penicillin amidohydrolase pac 580 periplasmic space antibiotic biosynthetic process, response to antibiotic 1764029 54 236:289 ALLVPRYDQPAPMLDRPAKGTDGALLAVTAIKNRETIAAQFANGANGLAGYPTT
PSQ00811 FND00206 Heat-stable enterotoxin A3 P07965 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 34 toxin activity 72 ST-H, ST-IB, STA3 sta3 562 extracellular space pathogenesis 6759126 34 20:53 QDAKPVESSKEKITLESKKCNIAKKSNKSGPESM
PSQ00814 FD00406 Lantibiotic epidermin P08136 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 30 signaling receptor binding 59 None epiA 1282 extracellular region cytolysis, defense response to bacterium 3769923 30 1:30 MEAVKEKNDLFNLDVKVNAKESNDSGAEPR
PSQ00818 FD00011 Aqualysin-1 P08594 Bacteria Deinococcus-Thermus Deinococci Thermales Thermaceae Thermus Thermus aquaticus 113 serine-type endopeptidase activity 513 Aqualysin-I pstI 271 extracellular region None 3162211 113 15:127 VLGGCQMASRSDPTPTLAEAFWPKEAPVYGLDDPEAIPGRYIVVFKKGKGQSLLQGGITTLQARLAPQGVVVTQAYTGALQGFAAEMAPQALEAFRQSPDVEFIEADKVVRAW
PSQ00826 FD00517 ATP synthase subunit b P09221 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus sp 11 proton-transporting ATP synthase activity, rotational mechanism 163 ATP synthase F(0) sector subunit b , ATPase subunit I , F-type ATPase subunit b atpF 2334 integral component of membrane, plasma membrane, proton-transporting ATP synthase complex, coupling factor F(o) None 2894854 11 1:11 MLWKANVWVLG
PSQ00829 FD00459 Hemolysin P09545 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae serotype O1 (strain ATCC 39315 132 carbohydrate binding, identical protein binding, toxin activity 741 None hlyA 243277 extracellular region, host cell plasma membrane, integral component of membrane hemolysis in other organism, pathogenesis 2174833 132 26:157 NINEPSGEAADIISQVADSHAIKYYNAADWQAEDNALPSLAELRDLVINQQKRVLVDFSQISDAEGQAEMQAQFRKAYGVGFANQFIVITEHKGELLFTPFDQAEEVDPQLLEAPRTARLLARSGFASPAPA
PSQ00831 FD00245 Phospholipase C P09598 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus cereus 14 phosphatidylcholine phospholipase C activity, zinc ion binding 283 Cereolysin A, Phosphatidylcholine cholinephosphohydrolase plc 1396 None hemolysis in other organism 1939031, 72664 14 25:38 HENDGGSKIKIVHR
PSQ00835 FD00190 Fimbrial protein P09829 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Moraxella Moraxella nonliquefaciens 6 None 154 Pilin tfpA 478 integral component of membrane, pilus cell adhesion 838045 6 1:6 MNAQKG
PSQ00840 FD00583 Bacteriocin lactococcin-A P0A313 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 21 None 75 None lcnA 1359 extracellular region, host cell plasma membrane, integral component of membrane cytolysis, defense response to bacterium 1904860 21 1:21 MKNQLNFNIVSDEELSEANGG
PSQ00841 FND00307 Heat-stable enterotoxin ST P0A4M3 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae 43 toxin activity 78 Non O1-ST, Non-agglutinating cholera vibrios ST stn 666 extracellular space pathogenesis 4065341 43 19:61 QTVENNKKTVQQPQQIESKVNIKKLSENEECPFIKQVDENGNL
PSQ00842 FD00541 ATP-dependent Clp protease proteolytic subunit P0A6G7 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 14 ATP-dependent peptidase activity, ATPase binding, identical protein binding, serine-type endopeptidase activity, serine-type peptidase activity 207 Caseinolytic protease, Endopeptidase Clp , Heat shock protein F21, Protease Ti clpP 83333 cytosol, endopeptidase Clp complex, HslUV protease complex, membrane positive regulation of programmed cell death, proteasomal protein catabolic process, protein quality control for misfolded or incompletely synthesized proteins, proteolysis, response to heat, response to radiation, response to temperature stimulus 2197275 14 1:14 MSYSGERDNFAPHM
PSQ00843 FD00355 Poly(A) polymerase I P0ABF1 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 10 ATP binding, polynucleotide adenylyltransferase activity, RNA binding 465 Plasmid copy number protein pcnB 83333 cytoplasm, cytosol, plasma membrane mRNA polyadenylation, mRNA processing, plasmid maintenance, RNA modification 1438224 10 1:10 MFTRVANFCR
PSQ00844 FD00570 Peptidoglycan D P0AD68 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 11 penicillin binding, peptidoglycan glycosyltransferase activity, serine-type D-Ala-D-Ala carboxypeptidase activity 588 Essential cell division protein FtsI , Murein transpeptidase , Penicillin-binding protein 3 , Peptidoglycan synthase FtsI ftsI 83333 cell division site, integral component of plasma membrane, intrinsic component of plasma membrane cell division, cell wall organization, division septum assembly, FtsZ-dependent cytokinesis, peptidoglycan biosynthetic process, regulation of cell shape, response to drug 2681146 11 578:588 INQGEGTGGRS
PSQ00845 FD00383 Streptopain P0C0J0 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus pyogenes 118 cysteine-type peptidase activity, toxin activity 398 Exotoxin type B, SPE B, Streptococcal cysteine proteinase, Streptococcus peptidase A speB 1314 extracellular region pathogenesis, proteolysis in other organism 2198264 118 28:145 DQNFARNEKEAKDSAITFIQKSAAIKAGARSAEDIKLDKVNLGGELSGSNMYVYNISTGGFVIVSGDKRSPEILGYSTSGSFDANGKENIASFMESYVEQIKENKKLDTTYAGTAEIK
PSQ00846 FD00066 Glutamyl endopeptidase P0C0Q1 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 39 serine-type endopeptidase activity 282 Glutamic acid-specific protease gseA 1282 extracellular region pathogenesis 11767947, 12127798 39 28:66 KTDTESHNHSSLGTENKNVLDINSSSHNIKPSQNKSYPS
Go to Lab Web Page