Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01607 FD00104 Regenerating islet-derived protein 3-alpha Q06141 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 carbohydrate binding, identical protein binding, oligosaccharide binding, peptidoglycan binding, signaling receptor activity 180 Hepatointestinal pancreatic protein, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha REG3A 9606 cytoplasm, extracellular region, extracellular space acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, cell wall disruption in other organism, heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to peptide hormone 19254208 11 27:37 EEPQRELPSAR
PSQ01651 FD00585 Pappalysin-1 Q13219 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 59 metalloendopeptidase activity, metallopeptidase activity, zinc ion binding 1627 Insulin-like growth factor-dependent IGF-binding protein 4 protease, Pregnancy-associated plasma protein A PAPPA 9606 extracellular region, extracellular space cellular protein metabolic process, female pregnancy, response to follicle-stimulating hormone, response to glucocorticoid 7508748, 7685339 59 23:81 ERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPPPPPPPGGAWEAVRVPRRRQQR
PSQ01652 FD00530 Apolipoprotein F Q13790 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 129 cholesterol binding, lipid transporter activity, signaling receptor binding 326 Lipid transfer inhibitor protein APOF 9606 extracellular space, high-density lipoprotein particle, low-density lipoprotein particle cholesterol metabolic process, lipid metabolic process, lipid transport 8093033, 9880564 129 36:164 ATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGR
PSQ01653 FD00197 Ectonucleotide pyrophosphatase Q13822 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 8 alkylglycerophosphoethanolamine phosphodiesterase activity, calcium ion binding, hydrolase activity, lysophospholipase activity, nucleic acid binding, nucleotide diphosphatase activity, phosphodiesterase I activity, polysaccharide binding, scavenger receptor activity, transcription factor binding, zinc ion binding 863 Autotaxin , Extracellular lysophospholipase D ENPP2 9606 extracellular space, plasma membrane cell motility, chemotaxis, immune response, phosphatidylcholine catabolic process, phospholipid catabolic process, positive regulation of epithelial cell migration, positive regulation of lamellipodium morphogenesis, positive regulation of peptidyl-tyrosine phosphorylation, regulation of angiogenesis, regulation of cell migration, sphingolipid catabolic process 12176993, 18175805 8 28:35 FTAHRIKR
PSQ01654 FD00208 Caspase-8 Q14790 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 216, 10 cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, cysteine-type peptidase activity, death effector domain binding, death receptor binding, identical protein binding, peptidase activity, protein-containing complex binding, scaffold protein binding, tumor necrosis factor receptor binding, ubiquitin protein ligase binding 480 Apoptotic cysteine protease, Apoptotic protease Mch-5 , CAP4, FADD-homologous ICE, FADD-like ICE , ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog CASP8 9606 CD95 death-inducing signaling complex, cell body, cytoplasm, cytoskeleton, cytosol, death-inducing signaling complex, membrane raft, mitochondrial outer membrane, mitochondrion, neuron projection, nucleoplasm, protein-containing complex, ripoptosome activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, angiogenesis, apoptotic process, apoptotic signaling pathway, B cell activation, cell surface receptor signaling pathway, cellular response to mechanical stimulus, cellular response to organic cyclic compound, death-inducing signaling complex assembly, execution phase of apoptosis, extrinsic apoptotic signaling pathway, extrinsic apoptotic signaling pathway via death domain receptors, heart development, macrophage differentiation, modulation by virus of host cellular process, natural killer cell activation, negative regulation of extrinsic apoptotic signaling pathway via death domain receptors, negative regulation of I-kappaB kinase/NF-kappaB signaling, negative regulation of necroptotic process, nucleotide-binding oligomerization domain containing signaling pathway, positive regulation of apoptotic process, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of interleukin-1 beta production, positive regulation of macrophage differentiation, positive regulation of neuron death, positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway, positive regulation of proteolysis, proteolysis, proteolysis involved in cellular protein catabolic process, pyroptosis, regulation of cytokine production, regulation of extrinsic apoptotic signaling pathway via death domain receptors, regulation of innate immune response, regulation of necroptotic process, regulation of tumor necrosis factor-mediated signaling pathway, response to antibiotic, response to cobalt ion, response to cold, response to estradiol, response to ethanol, response to lipopolysaccharide, response to tumor necrosis factor, self proteolysis, suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process, syncytiotrophoblast cell differentiation involved in labyrinthine layer development, T cell activation, toll-like receptor 3 signaling pathway, TRAIL-activated apoptotic signaling pathway, TRIF-dependent toll-like receptor signaling pathway 8962078, 9184224,;8962078, 9184224 226 1:216, 375:384 MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQD, SEEQPYLEMD
PSQ01656 FD00080 Guanylate cyclase activator 2B Q16661 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 62 calcium sensitive guanylate cyclase activator activity, guanylate cyclase activator activity 119 None GUCA2B 9606 extracellular exosome, extracellular region cGMP-mediated signaling, digestion, excretion 7589507 62 27:88 VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSI
PSQ01657 FD00279 Meprin A subunit beta Q16820 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 39 identical protein binding, metalloendopeptidase activity, zinc ion binding 701 Endopeptidase-2, Meprin B, N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit beta, PABA peptide hydrolase, PPH beta MEP1B 9606 extracellular region, integral component of plasma membrane, meprin A complex inflammatory response, toxin transport 8262185, 9288916 39 23:61 TPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIR
PSQ01764 FD00214 Retroviral-like aspartic protease 1 Q53RT3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 190, 17 aspartic-type endopeptidase activity 343 Skin-specific retroviral-like aspartic protease, TPA-inducible aspartic proteinase-like protein ASPRV1 9606 integral component of membrane protein processing, skin development 16098038;16098038 207 1:190, 327:343 MGSPGASLGIKKALQSEQATALPASAPAVSQPTAPAPSCLPKAGQVIPTLLREAPFSSVIAPTLLCGFLFLAWVAAEVPEESSRMAGSGARSEEGRRQHAFVPEPFDGANVVPNLWLHSFEVINDLNHWDHITKLRFLKESLRGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFAN, LIEEDPSSEEGRQELSH
PSQ01846 FD00260 Replication stress response regulator SDE2 Q6IQ49 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 77 damaged DNA binding 451 None SDE2 9606 cytosol, Golgi apparatus, nuclear speck, nucleoplasm, nucleus, plasma membrane cell cycle, cell division, cellular response to UV, DNA replication, protein processing, protein ubiquitination, regulation of cell cycle arrest 27906959 77 1:77 MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSLEPRLCGG
PSQ01865 FD00104 Regenerating islet-derived protein 3-gamma Q6UW15 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 oligosaccharide binding, peptidoglycan binding, signaling receptor activity 180 Pancreatitis-associated protein 1B, Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma REG3G 9606 cytoplasm, extracellular region, extracellular space acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, cell wall disruption in other organism, cytolysis by host of symbiont cells, defense response to Gram-positive bacterium, MyD88-dependent toll-like receptor signaling pathway, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to peptide hormone 19095652 11 27:37 EETQKELPSPR
PSQ01876 FD00546 A disintegrin and metalloproteinase with thrombospondin motifs 13 Q76LX8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 45 calcium ion binding, integrin binding, metalloendopeptidase activity, metallopeptidase activity, zinc ion binding 1427 von Willebrand factor-cleaving protease ADAMTS13 9606 cell surface, endoplasmic reticulum lumen, extracellular matrix, extracellular space cell-matrix adhesion, cellular response to interferon-gamma, cellular response to interleukin-4, cellular response to lipopolysaccharide, cellular response to tumor necrosis factor, extracellular matrix organization, glycoprotein metabolic process, integrin-mediated signaling pathway, peptide catabolic process, platelet activation, protein processing, proteolysis, response to amine, response to potassium ion, response to toxic substance 11535494, 11535495, 11574066 45 30:74 PSHFQQSCLQALEPQAVSSYLSPGAPLKGRPPSPGFQRQRQRQRR
PSQ01933 FD00466 Extracellular serine Q8IXL6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 70 ATP binding, manganese ion binding, phosphotransferase activity, alcohol group as acceptor, protein serine kinase activity, protein serine/threonine kinase activity, protein threonine kinase activity 584 Dentin matrix protein 4 , Golgi casein kinase , Golgi-enriched fraction casein kinase FAM20C 9606 endoplasmic reticulum lumen, extracellular exosome, extracellular space, Golgi apparatus ATP metabolic process, biomineral tissue development, cellular protein metabolic process, enamel mineralization, odontoblast differentiation, post-translational protein modification, protein phosphorylation 26091039 70 23:92 LHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQ
PSQ01949 FD00227 Proprotein convertase subtilisin Q8NBP7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 122 apolipoprotein binding, apolipoprotein receptor binding, low-density lipoprotein particle binding, low-density lipoprotein particle receptor binding, protein self-association, receptor inhibitor activity, RNA binding, serine-type endopeptidase activity, sodium channel inhibitor activity, very-low-density lipoprotein particle binding, very-low-density lipoprotein particle receptor binding 692 Neural apoptosis-regulated convertase 1, Proprotein convertase 9, Subtilisin PCSK9 9606 cell surface, COPII-coated ER to Golgi transport vesicle, cytoplasm, early endosome, endolysosome membrane, endoplasmic reticulum, endoplasmic reticulum lumen, extracellular region, extracellular space, extrinsic component of external side of plasma membrane, Golgi apparatus, late endosome, lysosomal membrane, lysosome, PCSK9-AnxA2 complex, PCSK9-LDLR complex, perinuclear region of cytoplasm, plasma membrane, rough endoplasmic reticulum apoptotic process, cellular protein metabolic process, cellular response to insulin stimulus, cellular response to starvation, cholesterol homeostasis, cholesterol metabolic process, kidney development, lipoprotein metabolic process, liver development, low-density lipoprotein particle clearance, low-density lipoprotein particle receptor catabolic process, lysosomal transport, negative regulation of low-density lipoprotein particle clearance, negative regulation of low-density lipoprotein particle receptor binding, negative regulation of low-density lipoprotein receptor activity, negative regulation of receptor recycling, negative regulation of receptor-mediated endocytosis involved in cholesterol transport, negative regulation of sodium ion transmembrane transporter activity, neurogenesis, neuron differentiation, phospholipid metabolic process, positive regulation of low-density lipoprotein particle receptor catabolic process, positive regulation of neuron apoptotic process, positive regulation of receptor internalization, post-translational protein modification, protein autoprocessing, regulation of neuron apoptotic process, regulation of signaling receptor activity, triglyceride metabolic process 12552133 122 31:152 QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
PSQ01981 FD00225 Sortilin-related receptor Q92673 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 53 amyloid-beta binding, low-density lipoprotein particle binding, low-density lipoprotein particle receptor activity, neuropeptide binding, small GTPase binding, transmembrane signaling receptor activity 2220 Low-density lipoprotein receptor relative with 11 ligand-binding repeats, SorLA-1 , Sorting protein-related receptor containing LDLR class A repeats SORL1 9606 cell surface, early endosome, early endosome membrane, endoplasmic reticulum, endoplasmic reticulum membrane, endosome, endosome membrane, extracellular exosome, extracellular space, Golgi apparatus, Golgi cisterna, Golgi membrane, integral component of membrane, integral component of plasma membrane, membrane, multivesicular body, multivesicular body membrane, nuclear envelope lumen, perinucleolar compartment, plasma membrane, recycling endosome, recycling endosome membrane, trans-Golgi network, transport vesicle membrane adaptive thermogenesis, amyloid fibril formation, diet induced thermogenesis, insulin receptor recycling, negative regulation of amyloid-beta formation, negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of BMP signaling pathway, negative regulation of MAP kinase activity, negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of neurofibrillary tangle assembly, negative regulation of neurogenesis, negative regulation of neuron death, negative regulation of protein binding, negative regulation of protein-containing complex assembly, negative regulation of tau-protein kinase activity, negative regulation of triglyceride catabolic process, neuropeptide signaling pathway, positive regulation of adipose tissue development, positive regulation of choline O-acetyltransferase activity, positive regulation of early endosome to recycling endosome transport, positive regulation of endocytic recycling, positive regulation of ER to Golgi vesicle-mediated transport, positive regulation of glial cell-derived neurotrophic factor production, positive regulation of insulin receptor signaling pathway, positive regulation of protein catabolic process, positive regulation of protein exit from endoplasmic reticulum, positive regulation of protein localization to early endosome, post-Golgi vesicle-mediated transport, protein localization to Golgi apparatus, protein maturation, protein retention in Golgi apparatus, protein targeting, protein targeting to lysosome, receptor-mediated endocytosis, regulation of smooth muscle cell migration 8940146 53 29:81 EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKR
PSQ01997 FD00203 Proheparin-binding EGF-like growth factor Q99075 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 43 epidermal growth factor receptor binding, growth factor activity, heparin binding 208 None HBEGF 9606 cell surface, clathrin-coated endocytic vesicle membrane, endocytic vesicle membrane, extracellular region, extracellular space, integral component of plasma membrane, plasma membrane cell chemotaxis, epidermal growth factor receptor signaling pathway, ERBB2 signaling pathway, MAPK cascade, membrane organization, muscle organ development, negative regulation of elastin biosynthetic process, negative regulation of epidermal growth factor receptor signaling pathway, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of keratinocyte migration, positive regulation of protein kinase B signaling, positive regulation of smooth muscle cell proliferation, positive regulation of wound healing, regulation of cell motility, regulation of heart contraction, signal transduction, wound healing, spreading of epidermal cells 1556128 43 20:62 LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVR
PSQ01999 FD00124 Sortilin Q99523 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 44 enzyme binding, nerve growth factor binding, nerve growth factor receptor activity, neurotensin receptor activity, non-G protein-coupled, retromer complex binding 838 100 kDa NT receptor, Glycoprotein 95, Neurotensin receptor 3 SORT1 9606 cell surface, clathrin-coated pit, clathrin-coated vesicle, cytoplasmic vesicle, cytoplasmic vesicle membrane, cytosol, dendrite, early endosome, endoplasmic reticulum membrane, endosome membrane, Golgi apparatus, Golgi cisterna membrane, integral component of membrane, lysosomal membrane, lysosome, neuronal cell body, nuclear membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network transport vesicle endocytosis, endosome to lysosome transport, endosome transport via multivesicular body sorting pathway, extrinsic apoptotic signaling pathway via death domain receptors, G protein-coupled receptor signaling pathway, glucose import, Golgi to endosome transport, Golgi to lysosome transport, multicellular organism development, myotube differentiation, negative regulation of fat cell differentiation, negative regulation of lipoprotein lipase activity, neuropeptide signaling pathway, neurotrophin TRK receptor signaling pathway, ossification, plasma membrane to endosome transport, positive regulation of epithelial cell apoptotic process, post-Golgi vesicle-mediated transport, protein targeting to lysosome, regulation of gene expression, response to insulin, vesicle organization 9756851 44 34:77 QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR
PSQ02000 FD00219 Matrix metalloproteinase-19 Q99542 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 79 metalloendopeptidase activity, zinc ion binding 508 Matrix metalloproteinase RASI, Matrix metalloproteinase-18 MMP19 9606 extracellular matrix, extracellular region, extracellular space angiogenesis, cell differentiation, collagen catabolic process, extracellular matrix disassembly, extracellular matrix organization, luteolysis, ovarian follicle development, ovulation from ovarian follicle, proteolysis, response to cAMP, response to hormone 10809722 79 19:97 RVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLK
PSQ02010 FD00351 UL16-binding protein 2 Q9BZM5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 30 natural killer cell lectin-like receptor binding 246 ALCAN-alpha, NKG2D ligand 2, Retinoic acid early transcript 1H ULBP2 9606 anchored component of plasma membrane, cell surface, endoplasmic reticulum, external side of plasma membrane, extracellular region, extracellular space, plasma membrane natural killer cell activation, natural killer cell mediated cytotoxicity, viral process 11444831 30 217:246 SGTTQLRATATTLILCCLLIILPCFILPGI
PSQ02011 FD00195 Forkhead box protein P3 Q9BZS1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 14 DNA binding, DNA-binding transcription factor activity, DNA-binding transcription factor activity, RNA polymerase II-specific, DNA-binding transcription repressor activity, RNA polymerase II-specific, histone acetyltransferase binding, histone deacetylase binding, metal ion binding, NF-kappaB binding, NFAT protein binding, protein homodimerization activity, RNA polymerase II cis-regulatory region sequence-specific DNA binding, sequence-specific DNA binding, sequence-specific double-stranded DNA binding, transcription corepressor activity 431 Scurfin FOXP3 9606 chromatin, cytoplasm, nucleoplasm, nucleus, protein-containing complex B cell homeostasis, CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment, chromatin remodeling, gene expression, myeloid cell homeostasis, negative regulation of activated T cell proliferation, negative regulation of cell population proliferation, negative regulation of chronic inflammatory response, negative regulation of CREB transcription factor activity, negative regulation of cytokine production, negative regulation of DNA-binding transcription factor activity, negative regulation of histone acetylation, negative regulation of histone deacetylation, negative regulation of immune response, negative regulation of interferon-gamma production, negative regulation of interleukin-10 production, negative regulation of interleukin-17 production, negative regulation of interleukin-2 production, negative regulation of interleukin-4 production, negative regulation of interleukin-5 production, negative regulation of interleukin-6 production, negative regulation of isotype switching to IgE isotypes, negative regulation of NF-kappaB transcription factor activity, negative regulation of T cell cytokine production, negative regulation of T cell proliferation, negative regulation of T-helper 17 cell differentiation, negative regulation of transcription by RNA polymerase II, negative regulation of transcription, DNA-templated, negative regulation of tumor necrosis factor production, positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation, positive regulation of histone acetylation, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-4 production, positive regulation of peripheral T cell tolerance induction, positive regulation of T cell anergy, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of transforming growth factor beta1 production, regulation of isotype switching to IgG isotypes, regulation of regulatory T cell differentiation, regulation of T cell anergy, regulation of transcription by RNA polymerase II, regulation of transcription, DNA-templated, regulation of Wnt signaling pathway, response to lipopolysaccharide, response to virus, T cell activation, T cell homeostasis, T cell mediated immunity, T cell receptor signaling pathway, tolerance induction to self antigen 19117830 14 418:431 SQRPSRCSNPTPGP
PSQ02048 FD00050 Interleukin-37 Q9NZH6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 45 cytokine activity, interleukin-1 receptor binding 218 FIL1 zeta, IL-1X, Interleukin-1 family member 7, Interleukin-1 homolog 4, Interleukin-1 zeta, Interleukin-1-related protein, Interleukin-23 IL37 9606 cytosol, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm cellular response to cytokine stimulus, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, immune response, inflammatory response, inflammatory response to antigenic stimulus, negative regulation of interleukin-6 production, negative regulation of tumor necrosis factor production, positive regulation of gene expression, regulation of inflammatory response 11145836 45 1:45 MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNF
Go to Lab Web Page