Details of PSQ00841
| ProSeqID |
PSQ00841 |
| Family |
FND00307 |
| Protein Name |
Heat-stable enterotoxin ST |
| UniProt ID |
P0A4M3
|
| Taxonomy |
Bacteria-Proteobacteria-Gammaproteobacteria-Vibrionales-Vibrionaceae-Vibrio |
| Organisms |
Vibrio cholerae |
| Prosequence Length (aa) |
43 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
78 |
| Alt Name |
Non O1-ST, Non-agglutinating cholera vibrios ST |
| Gene Name |
stn |
| NCBI ID |
666 |
| Cellular Localization |
extracellular space |
| Processes |
pathogenesis |
| PubMed |
4065341
|
| Total Prosequence Length (aa) |
43 |
| Prosequence Location |
19:61 |
| Prosequence Sequence |
QTVENNKKTVQQPQQIESKVNIKKLSENEECPFIKQVDENGNL |
| Preproprotein Sequence |
MRNLFIALMLLFSSIAFSQTVENNKKTVQQPQQIESKVNIKKLSENEECPFIKQVDENGNLIDCCEICCNPACFGCLN |