Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01460 FD00157 Minor fimbrium subunit Mfa1 P81363 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 31 None 498 53 kDa major outer membrane protein mfa1 837 cell outer membrane, outer membrane, pilus shaft cell-cell adhesion, pathogenesis 8208139 31 20:50 CSKEGNGPAPDSSSTADTHMSVSMSLPQHNR
PSQ01463 FD00378 Protein-glutamine gamma-glutamyltransferase P81453 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces mobaraensis (Streptoverticillium mobaraense) 45 protein-glutamine gamma-glutamyltransferase activity 407 MTG, Transglutaminase None 35621 None None 8099353 45 32:76 DNGAGEETKSYAETYRLTADDVANINALNESAPAASSAGPSFRAP
PSQ01505 FD00367 Transglutaminase-activating metalloprotease P83543 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces mobaraensis (Streptoverticillium mobaraense) 196 calcium ion binding, metalloendopeptidase activity, serine-type endopeptidase activity 760 Transglutaminase-activating metalloproteinase None 35621 extracellular region, membrane None 12869197 196 34:229 GQDKAAHPAPRQSIHKPDPGAEPVKLTPSQRAELIRDANATKAETAKNLGLGAKEKLVVKDVVKDKNGTLHTRYERTYDGLPVLGGDLVVDATRSGQVKTAAKATKQRIAVASTTPSLAASAAEKDAVKAARAKGSKAGKADKAPRKVVWAAKGTPVLAYETVVGGVQDDGTPSQLHVITDAKTGKKLFEFQGVKQ
PSQ01510 FD00077 Prolyl tri P83615 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces mobaraensis (Streptoverticillium mobaraense) 6 aminopeptidase activity 480 Tripeptidyl aminopeptidase ptp 35621 cell surface, extracellular region None 14519127, 15598885 6 28:33 ASITAP
PSQ01553 FND00210 Lantibiotic epilancin 15X P86047 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 24 signaling receptor binding 60 None elxA 1282 None cytolysis, defense response to bacterium 15792796, 21802007 24 1:24 MKKELFDLNLNKDIEAQKSDLNPQ
PSQ01560 FD00038 Lantibiotic lichenicidin VK21 A1 P86475 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus licheniformis 42 signaling receptor binding 74 None lchA1 1402 extracellular space cytolysis, defense response to Gram-positive bacterium 20578714 42 1:42 MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG
PSQ01561 FND00281 Lantibiotic lichenicidin VK21 A2 P86476 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus licheniformis 40 signaling receptor binding 72 None lchA2 1402 extracellular space cytolysis, defense response to Gram-positive bacterium 20578714 40 1:40 MKTMKNSAAREAFKGANHPAGMVSEEELKALVGGNDVNPE
PSQ01573 FD00488 Gingipain R2 P95493 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis (strain ATCC BAA-308 205 calcium ion binding, calcium-dependent cysteine-type endopeptidase activity 736 Arg-gingipain, Gingipain 2, RGP-2 rgpB 242619 extracellular region pathogenesis, proteolysis 9705298 205 25:229 QPAERGRNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISLVKNSTFTGFEDIYKSVFMNYEATR
PSQ01577 FD00067 Proteasome subunit beta P9WHT9 Bacteria Actinobacteria Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis (strain ATCC 25618 57 threonine-type endopeptidase activity, zymogen binding 298 20S proteasome beta subunit , Proteasome core protein PrcB prcB 83332 cytoplasm, extracellular region, plasma membrane, proteasome core complex, alpha-subunit complex, proteasome core complex, beta-subunit complex mitigation of host defenses by symbiont, modification-dependent protein catabolic process, pathogenesis, proteasomal protein catabolic process, proteolysis involved in cellular protein catabolic process 16468985 57 1:57 MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHG
PSQ01578 FND00353 Low molecular weight antigen MTB12 P9WIN7 Bacteria Actinobacteria Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis (strain ATCC 25618 26 None 168 CFP-2, Low molecular weight protein antigen 2 mtb12 83332 cell wall, extracellular region None 10812229, 9712769 26 23:48 GVTSIMAGGPVVYQMQPVVFGAPLPL
PSQ01579 FD00307 Type II secretion system core protein G Q00514 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 8 None 142 General secretion pathway protein G, PilD-dependent protein PddA xcpT 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 8 1:8 MQRRQQSG
PSQ01580 FD00326 Type II secretion system protein H Q00515 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 179 General secretion pathway protein H, PilD-dependent protein PddB xcpU 208964 integral component of membrane, plasma membrane, type II protein secretion system complex, type IV pilus bacterial-type flagellum-dependent swarming motility, protein secretion by the type II secretion system, single-species biofilm formation, type IV pilus biogenesis, type IV pilus-dependent motility 8331069 6 1:6 MRASRG
PSQ01581 FD00453 Type II secretion system protein I Q00516 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 129 General secretion pathway protein I, PilD-dependent protein PddC xcpV 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 6 1:6 MKRARG
PSQ01582 FD00458 Type II secretion system protein J Q00517 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 240 General secretion pathway protein J, PilD-dependent protein PddD xcpW 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 6 1:6 MRLQRG
PSQ01583 FD00196 Type II secretion system protein K Q00518 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 7 None 333 General secretion pathway protein K xcpX 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 9466253 7 1:7 MRRGQNG
PSQ01592 FD00441 Bacterial leucyl aminopeptidase Q01693 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio proteolyticus (Aeromonas proteolytica) 85, 99 aminopeptidase activity, metal ion binding 504 None None 671 extracellular region None 1569090, 1627651,;1627651 184 22:106, 406:504 EDKVWISIGADANQTVMKSGAESILPNSVASSGQVWVGQVDVAQLAELSHNMHEEHNRCGGYMVHPSAQSAMAASAMPTTLASFV, LEDGVPVTDLSGSRGSNVWYTFELETQKNLQITTSGGYGDLDLYVKFGSKASKQNWDCRPYLSGNNEVCTFNNASPGTYSVMLTGYSNYSGASLKASTF
PSQ01596 FD00391 Epsilon-toxin type B Q02307 Bacteria Firmicutes Clostridia Clostridiales Clostridiaceae Clostridium Clostridium perfringens 13 toxin activity 328 None etxB 1502 None pathogenesis 1729175 13 33:45 KEISNTVSNEMSK
PSQ01605 FD00280 Alkaline phosphatase Q05205 Bacteria Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Lysobacter Lysobacter enzymogenes 119 acid phosphatase activity, alkaline phosphatase activity 540 None phoA 69 extracellular region None 1856159 119 30:148 AQRILQLSEDTTHSKPVSAASALRGTPLAKAGAADRVCEAGAKWLRVGFKQLKLAGYDSLVLTSSGGDKLVFEGQHWNQRSFTTRPLRGECVDIQPYFSQPDSAFQLDRYDYSTVALDK
PSQ01606 FD00276 Glutamate synthase Q05755 Bacteria Proteobacteria Alphaproteobacteria Rhodospirillales Rhodospirillaceae Azospirillum Azospirillum brasilense 36 3 iron, 4 sulfur cluster binding, glutamate synthase (NADPH) activity, metal ion binding 1515 Glutamate synthase subunit alpha, NADPH-GOGAT gltB 192 None glutamine metabolic process, L-glutamate biosynthetic process 8428988 36 1:36 MTTELNQGEQFVADFRANAAALTTANAYNPEDEHDA
PSQ01609 FD00295 Extracellular minor metalloprotease Q06517 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia unclassified Serratia Serratia marcescens (strain ATCC 21074 218 metal ion binding, metalloendopeptidase activity 359 None smp 617 extracellular region None 8449415 218 52:269 NARAGERSAISTTPERHPTARQTGAQGGAAQQPRRAVDEAYDHLGVTYDFFWQAYRRNSVDNKGLPLVQRALRQGLPEQLSGTASRWCSETATARSSTVSPSPSTLVGHELTHGSDRERSRLIYYQQSGALNESLSDVFGSLVKQFHLQQTADKADWLIGAGLLAKGIKGKGLRSMSAPGTAYDDPLLGKDPQPASMKDYIQTKEDNGGVHLNSGIPN
Go to Lab Web Page