Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ02049 FD00050 Interleukin-36 gamma Q9NZH8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 17 cytokine activity, interleukin-1 receptor binding 169 IL-1-related protein 2, Interleukin-1 epsilon, Interleukin-1 family member 9, Interleukin-1 homolog 1 IL36G 9606 cytoplasm, extracellular region, extracellular space cell-cell signaling, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of gene expression 21965679 17 1:17 MRGTPGDADGGGRAVYQ
PSQ02050 FD00004 Kallikrein-14 Q9P0G3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 serine-type endopeptidase activity 267 Kallikrein-like protein 6 KLK14 9606 extracellular region, extracellular space, secretory granule cornification, epidermis morphogenesis, fertilization, negative regulation of G protein-coupled receptor signaling pathway, positive regulation of G protein-coupled receptor signaling pathway, proteolysis, seminal clot liquefaction 16800737 6 35:40 QEDENK
PSQ02051 FD00555 A disintegrin and metalloproteinase with thrombospondin motifs 9 Q9P2N4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 269 metalloendopeptidase activity, metallopeptidase activity, zinc ion binding 1935 None ADAMTS9 9606 endoplasmic reticulum, extracellular matrix, extracellular region, intracellular membrane-bounded organelle aorta morphogenesis, endothelial cell-matrix adhesion, extracellular matrix organization, glycoprotein catabolic process, heart valve morphogenesis, multicellular organism development, negative regulation of endothelial cell migration, negative regulation of sprouting angiogenesis, protein transport, proteolysis, ventricular cardiac muscle tissue development, vesicle-mediated transport 12514189 269 19:287 EMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALGEPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKR
PSQ02075 FD00419 Golgi-associated kinase 1A Q9UFP1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 90, 139 None 575 Protein FAM198A GASK1A 9606 caveola, endoplasmic reticulum, extracellular region, Golgi apparatus, intracellular membrane-bounded organelle None 30188967;30188967 229 30:119, 437:575 VTRFPPQRPSAGPDPGPMEPQGVTGAPATHIRQALSSSRRQRARNMGFWRSRALPRNSILVCAEEQGHRARVDRSRESPGGDLRHPGRVR, RYCCGFEPEPSDPCVEERLREKCQNPAELRLVHILVRSSDPSHLVYIDNAGNLQHPEDKLNFRLLEGIDGFPESAVKVLASGCLQNMLLKSLQMDPVFWESQGGAQGLKQVLQTLEQRGQVLLGHIQKHNLTLFRDEDP
PSQ02076 FD00209 A disintegrin and metalloproteinase with thrombospondin motifs 7 Q9UKP4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 209 metal ion binding, metalloendopeptidase activity, metallopeptidase activity 1686 COMPase ADAMTS7 9606 endoplasmic reticulum lumen, extracellular matrix, extracellular region cellular response to BMP stimulus, cellular response to interleukin-1, cellular response to tumor necrosis factor, extracellular matrix organization, negative regulation of chondrocyte differentiation, proteolysis involved in cellular protein catabolic process 15192113 209 28:236 APGPAPGRATEGRAALDIVHPVRVDAGGSFLSYELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAHIRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQPHVVYKRQAPERLAQRGDSSAPSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQR
PSQ02077 FD00507 A disintegrin and metalloproteinase with thrombospondin motifs 5 Q9UNA0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 245 endopeptidase activity, extracellular matrix binding, heparin binding, integrin binding, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, zinc ion binding 930 A disintegrin and metalloproteinase with thrombospondin motifs 11, ADMP-2, Aggrecanase-2 ADAMTS5 9606 collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space defense response to bacterium, extracellular matrix disassembly, extracellular matrix organization, myoblast fusion, negative regulation of cold-induced thermogenesis, proteolysis, tooth eruption 18992360 245 17:261 LAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRR
PSQ02097 FD00448 Heparanase Q9Y251 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 48 beta-glucuronidase activity, heparanase activity, syndecan binding 543 Endo-glucoronidase, Heparanase-1 HPSE 9606 extracellular matrix, extracellular region, heparanase complex, intracellular membrane-bounded organelle, lysosomal lumen, lysosomal membrane, lysosome, membrane raft, nucleoplasm, nucleus, specific granule lumen angiogenesis involved in wound healing, cell-matrix adhesion, glycosaminoglycan catabolic process, heparan sulfate proteoglycan catabolic process, neutrophil degranulation, positive regulation of blood coagulation, positive regulation of hair follicle development, positive regulation of osteoblast proliferation, positive regulation of protein kinase B signaling, positive regulation of vascular endothelial growth factor production, proteoglycan metabolic process, regulation of hair follicle development, vascular wound healing 10395326, 10446189, 12713442 48 110:157 STFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQ
PSQ02098 FD00126 Beta-secretase 2 Q9Y5Z0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 42 aspartic-type endopeptidase activity 518 Aspartic-like protease 56 kDa, Aspartyl protease 1, Beta-site amyloid precursor protein cleaving enzyme 2, Down region aspartic protease, Memapsin-1, Membrane-associated aspartic protease 1, Theta-secretase BACE2 9606 dense core granule, endoplasmic reticulum, endosome, Golgi apparatus, integral component of membrane, membrane, plasma membrane, trans-Golgi network amyloid-beta metabolic process, astrocyte activation, glucose homeostasis, membrane protein ectodomain proteolysis, negative regulation of amyloid precursor protein biosynthetic process, peptide hormone processing, proteolysis 10591213, 11083922, 11423558, 16305800, 16816112 42 21:62 APELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLAL
PSQ02099 FD00500 Carboxypeptidase Q Q9Y646 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 24 carboxypeptidase activity, metal ion binding, metallodipeptidase activity, protein homodimerization activity 479 Lysosomal dipeptidase, Plasma glutamate carboxypeptidase CPQ 9606 cytoplasm, endoplasmic reticulum, extracellular exosome, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosome peptide catabolic process, proteolysis, thyroid hormone generation, tissue regeneration 10206990, 12675526 24 21:44 KAICKNGISKRTFEEIKEEIASCG
PSQ02100 FD00185 Tolloid-like protein 2 Q9Y6L7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 124 calcium ion binding, metalloendopeptidase activity, zinc ion binding 1020 None TLL2 9606 extracellular region cell differentiation, collagen fibril organization, extracellular matrix disassembly, multicellular organism development, negative regulation of skeletal muscle tissue growth 10479448 124 26:149 LGERPDATADYSELDGEEGTEQQLEHYHDPCKAAVFWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAGKDGRENTTLLHSPGTLHAAAKTFSPRVRR
Go to Lab Web Page