Details of PSQ01579
| ProSeqID |
PSQ01579 |
| Family |
FD00307 |
| Protein Name |
Type II secretion system core protein G |
| UniProt ID |
Q00514
|
| Taxonomy |
Bacteria-Proteobacteria-Gammaproteobacteria-Pseudomonadales-Pseudomonadaceae-Pseudomonas |
| Organisms |
Pseudomonas aeruginosa (strain ATCC 15692 , 14847 |
| Prosequence Length (aa) |
8 |
| Functions |
None |
| Preproprotein Length (aa) |
142 |
| Alt Name |
General secretion pathway protein G, PilD-dependent protein PddA |
| Gene Name |
xcpT |
| NCBI ID |
208964 |
| Cellular Localization |
integral component of membrane, plasma membrane, type II protein secretion system complex |
| Processes |
protein secretion by the type II secretion system |
| PubMed |
8331069
|
| Total Prosequence Length (aa) |
8 |
| Prosequence Location |
1:8 |
| Prosequence Sequence |
MQRRQQSG |
| Preproprotein Sequence |
MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN |