Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ02051 FD00555 A disintegrin and metalloproteinase with thrombospondin motifs 9 Q9P2N4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 269 metalloendopeptidase activity, metallopeptidase activity, zinc ion binding 1935 None ADAMTS9 9606 endoplasmic reticulum, extracellular matrix, extracellular region, intracellular membrane-bounded organelle aorta morphogenesis, endothelial cell-matrix adhesion, extracellular matrix organization, glycoprotein catabolic process, heart valve morphogenesis, multicellular organism development, negative regulation of endothelial cell migration, negative regulation of sprouting angiogenesis, protein transport, proteolysis, ventricular cardiac muscle tissue development, vesicle-mediated transport 12514189 269 19:287 EMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALGEPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKR
PSQ02052 FD00011 Subtilisin-like serine protease Pen ch 18 Q9P8G3 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium Penicillium chrysogenum species complex Penicillium rubens 120 IgE binding, serine-type endopeptidase activity 494 Allergen Pen n 18 , Vacuolar serine protease None 1108849 None proteolysis 11964171 120 17:136 SPVAVNSIHNDAAPILSSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDFEAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTM
PSQ02053 FD00007 Factor V activator Q9PT41 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Macrovipera Macrovipera lebetina (Levantine viper) (Vipera lebetina) 6 serine-type endopeptidase activity, toxin activity 259 Lebetina viper venom FV activator, Snake venom serine protease None 8709 extracellular region None 9920400 6 19:24 QKSSEL
PSQ02054 FND00167 Dermatoxin-B1 Q9PT75 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) 20 None 77 Dermatoxin None 8393 extracellular region, membrane, other organism cell membrane defense response to bacterium 10880984 20 23:42 ESEKREGENEEEQEDDQSEE
PSQ02055 FD00004 Snake venom serine protease BPA Q9PTU8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops jararaca (Jararaca) (Bothrops jajaraca) 6 serine-type endopeptidase activity, toxin activity 258 Bothrops protease A None 8724 extracellular region None 14580991 6 19:24 QKSSEL
PSQ02056 FD00061 Cholecystokinin Q9PU29 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Palaeognathae Struthioniformes Struthionidae Struthio Struthio camelus (Common ostrich) 28, 9 hormone activity 130 None CCK 8801 axon, extracellular region axonogenesis, digestion, neuron migration 11072120;11072120 37 21:48, 122:130 QQTAGSHNGNPLAAELEQSLTEHHRHVR, SAEEYEYSS
PSQ02057 FD00061 Cholecystokinin Q9PU41 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 28, 9 hormone activity, neuropeptide hormone activity 130 None CCK 9031 axon, extracellular space axonogenesis, digestion, neuron migration 11072120;11072120 37 21:48, 122:130 QQPAGSHDGSPVAAELQQSLTEPHRHSR, SAEEYEYSS
PSQ02058 FD00303 Prion-like protein doppel Q9QUG3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 24 copper ion binding 180 Doppelganger, PrPLP Prnd 10090 anchored component of external side of plasma membrane acrosome reaction, cellular copper ion homeostasis, protein homooligomerization, single fertilization 10842180 24 156:179 AALRVAVDQPAMVCLLGFVWFIVK
PSQ02059 FD00029 Group 10 secretory phospholipase A2 Q9QXX3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 11 1-alkyl-2-acetylglycerophosphocholine esterase activity, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), phospholipase activity, phospholipid binding 151 Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 10 Pla2g10 10090 acrosomal vesicle, extracellular space, lysosome arachidonic acid secretion, axon guidance, cellular response to leukemia inhibitory factor, cholesterol homeostasis, defense response to virus, erythrocyte maturation, fertilization, hair follicle morphogenesis, intestinal stem cell homeostasis, low-density lipoprotein particle remodeling, lysophospholipid transport, macrophage activation, negative regulation of cholesterol efflux, negative regulation of cytokine production involved in inflammatory response, negative regulation of DNA-binding transcription factor activity, negative regulation of inflammatory response, phosphatidic acid metabolic process, phosphatidylcholine catabolic process, phosphatidylcholine metabolic process, phosphatidylethanolamine metabolic process, phosphatidylglycerol metabolic process, phosphatidylserine metabolic process, phospholipid metabolic process, platelet activating factor catabolic process, positive regulation of acrosome reaction, positive regulation of arachidonic acid secretion, positive regulation of cellular protein metabolic process, positive regulation of lipid storage, positive regulation of prostaglandin secretion, production of molecular mediator involved in inflammatory response, prostaglandin biosynthetic process, regulation of macrophage activation 11019817 11 18:28 EATRRSHVYKR
PSQ02060 FD00420 Appetite-regulating hormone Q9QYH7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 24 G protein-coupled receptor binding, ghrelin receptor binding, growth hormone-releasing hormone activity, hormone activity, protein tyrosine kinase activator activity 120 Growth hormone secretagogue, Growth hormone-releasing peptide, Motilin-related peptide Ghrl 10116 axon, cytoplasm, extracellular region, extracellular space, glutamatergic synapse, postsynapse, Schaffer collateral - CA1 synapse actin polymerization or depolymerization, activation of MAPK activity, adult feeding behavior, decidualization, dendrite development, energy homeostasis, excitatory postsynaptic potential, G protein-coupled receptor signaling pathway, gastric acid secretion, gastric emptying, negative regulation of apoptotic process, negative regulation of circadian sleep/wake cycle, REM sleep, negative regulation of endothelial cell proliferation, negative regulation of inflammatory response, negative regulation of insulin secretion, negative regulation of interleukin-1 beta production, negative regulation of interleukin-6 production, negative regulation of locomotion, negative regulation of tumor necrosis factor production, positive regulation of adipose tissue development, positive regulation of appetite, positive regulation of bone development, positive regulation of circadian sleep/wake cycle, non-REM sleep, positive regulation of cold-induced thermogenesis, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of cytosolic calcium ion concentration, positive regulation of eating behavior, positive regulation of feeding behavior, positive regulation of gastric mucosal blood circulation, positive regulation of gastro-intestinal system smooth muscle contraction, positive regulation of growth, positive regulation of growth hormone secretion, positive regulation of growth rate, positive regulation of insulin secretion, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of response to food, positive regulation of small intestinal transit, positive regulation of small intestine smooth muscle contraction, positive regulation of sprouting angiogenesis, positive regulation of synapse assembly, positive regulation of vascular endothelial cell proliferation, postsynaptic modulation of chemical synaptic transmission, regulation of cell population proliferation, regulation of gastric motility, regulation of postsynapse organization, regulation of response to food, regulation of transmission of nerve impulse, response to electrical stimulus, response to estrogen, response to hormone, response to nutrient levels 16284174 24 52:75 ALEGWLHPEDRGQAEEAEEELEIR
PSQ02061 FD00247 Peptidylarginine deiminase Q9RQJ2 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis (strain ATCC BAA-308 20 protein-arginine deiminase activity 556 None None 242619 extracellular region putrescine biosynthetic process 10377098 20 24:43 QTQMQADRTNGQFATEEMQR
PSQ02062 FD00342 Probable subtilase-type serine protease DR_A0283 Q9RYM8 Bacteria Deinococcus-Thermus Deinococci Deinococcales Deinococcaceae Deinococcus Deinococcus radiodurans (strain ATCC 13939 , 4051 126 serine-type endopeptidase activity 728 None None 243230 extracellular region None 15249204 126 23:148 ACGQPQTSPQSPAASAPSVAVPRTHALDIDPAQVVTTKNGDMYVRNQLVVNLRGHSADALADQLGGRVLDQLPELDVALIELPQGKDARSVGVALMREGQVLYAAAQTVQRQIEPVRTAQDQLGAQ
PSQ02063 FND00224 Uncharacterized protein DR_A0282 Q9RYM9 Bacteria Deinococcus-Thermus Deinococci Deinococcales Deinococcaceae Deinococcus Deinococcus radiodurans (strain ATCC 13939 , 4051 212 None 504 None None 243230 None None 15249204 212 1:212 MFMKSKAAGSEFDGAVAKDNVNTRLKIAQFMSADPNATADVPQLKLETPTAFKANGEVDTWGPLGSGTAFNDVVNVRAYSVKNSDQPRVMRYFLFSLVNIDKDGTWSDVRPAAGLYEQDPGYVTPGVDPNNKGQGQDSGLVSLDATGLEGDVYLQVVGLDFNYNRVAYLVPLKLNRTKAASEVVAPTNVRAIAYTLSTRIDYLYKTQDPVLD
PSQ02064 FND00294 Silaffin-1 Q9SE35 Eukaryota Sar Stramenopiles Ochrophyta Bacillariophyta Bacillariophyceae Bacillariophycidae Bacillariales Bacillariaceae Cylindrotheca Cylindrotheca fusiformis (Marine diatom) 88 None 265 natSil-1 SIL1 2853 None biomineral tissue development 10550045 88 20:107 QSIADLAAANLSTEDSKSAQLISADSSDDASDSSVESVDAASSDVSGSSVESVDVSGSSLESVDVSGSSLESVDDSSEDSEEEELRIL
PSQ02065 FD00361 Polyneuridine-aldehyde esterase Q9SE93 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Apocynaceae Rauvolfioideae Vinceae Rauvolfiinae Rauvolfia Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) 6 polyneuridine-aldehyde esterase activity 264 Polyneuridine aldehyde esterase PNAE 4060 None indole alkaloid metabolic process 10691977 6 1:6 MHSAAN
PSQ02066 FND00061 Arabinogalactan protein 13 Q9STQ3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 13 AGP13 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 22 38:59 DASLAIPAFFASVATLAFGFLF
PSQ02067 FD00054 Endonuclease 1 Q9SXA6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 19 double-stranded DNA exodeoxyribonuclease activity, endonuclease activity, endoribonuclease activity, endoribonuclease activity, producing 5, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity, T/G mismatch-specific endonuclease activity 305 Bifunctional nuclease I , Deoxyribonuclease ENDO1 , Single-stranded-nucleate endonuclease ENDO1 ENDO1 3702 None DNA catabolic process, floral organ senescence, leaf senescence, RNA phosphodiester bond hydrolysis, endonucleolytic 23620482 19 287:305 MILNRVFSDDHAIAGVAAT
PSQ02068 FD00411 A disintegrin and metalloproteinase with thrombospondin motifs 4 Q9TT93 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 161 metal ion binding, metalloendopeptidase activity, metallopeptidase activity, peptidase activity 840 ADMP-1, Aggrecanase-1 ADAMTS4 9913 extracellular matrix, extracellular region extracellular matrix organization 10356395 161 52:212 ASPLPREEEIVFPEKLNGSVLPGLGAPARLLYRLPAFGETLLLELEKDPGVQVEGLTVQYLGRAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGTELHIQPLEGGAPNSAGGPGAHILRRKSPVSGQGPMCNVKAPPGKPSPSPRRAKR
PSQ02069 FD00438 Apelin Q9TUI9 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 19 apelin receptor binding, hormone activity 77 APJ endogenous ligand APLN 9913 extracellular region, extracellular space angiogenesis, apelin receptor signaling pathway, coronary vasculature development, drinking behavior, gastrulation, negative regulation of blood pressure, positive regulation of G protein-coupled receptor internalization, positive regulation of heart contraction 9792798 19 23:41 GPLLQTSDGKEMEEGTIRY
PSQ02070 FD00003 Delta-conotoxin GmVIA Q9TWM7 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus gloriamaris (Glory-of-the-Seas cone) 26 sodium channel inhibitor activity, toxin activity 77 None None 37336 extracellular region pathogenesis 7918355 26 23:48 DDSGNGMEILFPKAGHEMENLEVSNR
PSQ02071 FD00292 Serine-repeat antigen protein 5 Q9TY95 Eukaryota Sar Alveolata Apicomplexa Aconoidasida Haemosporida Plasmodiidae Plasmodium Plasmodium (Laverania) Plasmodium falciparum (isolate 3D7) 44 cysteine-type endopeptidase activity, cysteine-type peptidase activity, kinase binding, peptidase activity, serine-type peptidase activity 997 111 kDa antigen, Serine protease SERA5 , p126 SERA5 36329 extracellular space, lysosome, plasma membrane, symbiont-containing vacuolar space, symbiont-containing vacuole exit from host cell, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of immune response 24769454, 25599609 44 843:886 KASPEFYHNLYFKNFNVGKKNLFSEKEDNENNKKLGNNYIIFGQ
PSQ02072 FD00120 Putative inactive caspase B Q9TZP5 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 8 caspase binding, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, zymogen binding 263 None csp-2 6239 cytoplasm, protease inhibitor complex activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, execution phase of apoptosis, inhibition of cysteine-type endopeptidase activity involved in apoptotic process, negative regulation of apoptotic process, positive regulation of apoptotic process involved in development, positive regulation of brood size, positive regulation of fertilization 9857046 8 1:8 MMCEDASD
PSQ02073 FD00091 DELTA-stichotoxin-Hmg2a Q9U6X1 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Stichodactylidae Heteractis Heteractis magnifica (Magnificent sea anemone) (Radianthus magnifica) 15 channel activity, toxin activity 211 Cytolysin III, Cytolysin-3, HMg III , Magnificalysin III None 38281 extracellular region, nematocyst, other organism cell membrane, pore complex cation transport, hemolysis in other organism involved in symbiotic interaction, pore complex assembly 10719170 15 20:34 VPSREELEDQKEYKR
PSQ02074 FD00014 Conotoxin p5a Q9U6Z6 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Chelyconus Conus purpurascens (Purple cone) 31 toxin activity 63 P5, PVA None 41690 extracellular region None 10521453 31 20:50 VDAHPKTKDDMPLASFHDNAKGTLQRFWKKR
PSQ02075 FD00419 Golgi-associated kinase 1A Q9UFP1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 90, 139 None 575 Protein FAM198A GASK1A 9606 caveola, endoplasmic reticulum, extracellular region, Golgi apparatus, intracellular membrane-bounded organelle None 30188967;30188967 229 30:119, 437:575 VTRFPPQRPSAGPDPGPMEPQGVTGAPATHIRQALSSSRRQRARNMGFWRSRALPRNSILVCAEEQGHRARVDRSRESPGGDLRHPGRVR, RYCCGFEPEPSDPCVEERLREKCQNPAELRLVHILVRSSDPSHLVYIDNAGNLQHPEDKLNFRLLEGIDGFPESAVKVLASGCLQNMLLKSLQMDPVFWESQGGAQGLKQVLQTLEQRGQVLLGHIQKHNLTLFRDEDP
PSQ02076 FD00209 A disintegrin and metalloproteinase with thrombospondin motifs 7 Q9UKP4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 209 metal ion binding, metalloendopeptidase activity, metallopeptidase activity 1686 COMPase ADAMTS7 9606 endoplasmic reticulum lumen, extracellular matrix, extracellular region cellular response to BMP stimulus, cellular response to interleukin-1, cellular response to tumor necrosis factor, extracellular matrix organization, negative regulation of chondrocyte differentiation, proteolysis involved in cellular protein catabolic process 15192113 209 28:236 APGPAPGRATEGRAALDIVHPVRVDAGGSFLSYELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAHIRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQPHVVYKRQAPERLAQRGDSSAPSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQR
PSQ02077 FD00507 A disintegrin and metalloproteinase with thrombospondin motifs 5 Q9UNA0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 245 endopeptidase activity, extracellular matrix binding, heparin binding, integrin binding, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, zinc ion binding 930 A disintegrin and metalloproteinase with thrombospondin motifs 11, ADMP-2, Aggrecanase-2 ADAMTS5 9606 collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space defense response to bacterium, extracellular matrix disassembly, extracellular matrix organization, myoblast fusion, negative regulation of cold-induced thermogenesis, proteolysis, tooth eruption 18992360 245 17:261 LAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRR
PSQ02078 FD00027 Versatile peroxidase VPL1 Q9UR19 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Pleurotaceae Pleurotus Pleurotus eryngii (Boletus of the steppes) 8 23:30 361 Versatile liquid phase peroxidase 1 vpl1 5323 extracellular region hydrogen peroxide catabolic process, lignin catabolic process, response to oxidative stress 9987124 8 23:30 AVPLVQKR
PSQ02079 FD00011 Subtilisin-like serine protease Pen ch 13 Q9URR2 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium Penicillium chrysogenum species complex Penicillium rubens 96 serine-type endopeptidase activity 397 Alkaline serine protease , Allergen Pen n 13 None 1108849 extracellular space proteolysis 10694469 96 20:115 GTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNAT
PSQ02080 FD00027 Versatile peroxidase VPS1 Q9UVP6 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Pleurotaceae Pleurotus Pleurotus eryngii (Boletus of the steppes) 11 21:31 370 Versatile solid phase peroxidase 1 vps1 5323 extracellular region hydrogen peroxide catabolic process, lignin catabolic process, response to oxidative stress 10187820, 11004397 11 21:31 ESPTHRCLNKR
PSQ02081 FD00249 Serine protease 7 Q9V3Z2 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 109 metal ion binding, serine-type endopeptidase activity 391 Melanization protease 2 Sp7 7227 extracellular region, extracellular space defense response to Gram-positive bacterium, melanization defense response, positive regulation of melanization defense response, proteolysis 24260243 109 28:136 QGSCRNPNQKQGQCLSIYDCQSLLSVIQQSYVSPEDRTFLRNSQCLDGVGRQPYVCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNK
PSQ02082 FND00358 Neuropeptide F Q9VET0 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6, 37 G protein-coupled receptor binding, neuropeptide F receptor binding, neuropeptide hormone activity 102 dNPF NPF 7227 extracellular region circadian behavior, circadian rhythm, digestion, endocrine signaling, G protein-coupled receptor signaling pathway, larval feeding behavior, larval foraging behavior, larval locomotory behavior, locomotor rhythm, male courtship behavior, neuropeptide signaling pathway, olfactory behavior, regulation of response to food, response to odorant, social behavior 10499420;10499420 43 27:32, 66:102 SNSRPP, GSLMDILRNHEMDNINLGKNANNGGEFARGFNEEEIF
PSQ02083 FD00189 Serine protease HTRA2 Q9VFJ3 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 57 peptidase activity, serine-type endopeptidase activity 422 High temperature requirement protein A2 , Omi stress-regulated endoprotease HtrA2 7227 cytosol, integral component of membrane, mitochondrial intermembrane space, mitochondrial membrane, mitochondrion, Nebenkern apoptotic process, ectopic germ cell programmed cell death, mitochondrion organization, positive regulation of apoptotic process, positive regulation of cysteine-type endopeptidase activity, regulation of apoptotic process, spermatogenesis 18259196 57 18:74 ASPVLHSHAANRRSSQLAIKEGDPNSNGNSGQYQQNGEQKEKGWRRLVRFFVPFSLG
PSQ02084 FND00209 Protein hugin Q9VG55 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 95, 7 ecdysis-triggering hormone activity, hormone activity, myostimulatory hormone activity, neuropeptide receptor binding, signaling receptor binding 191 None Hug 7227 extracellular region, extracellular space ecdysis, chitin-based cuticle, larval feeding behavior, neuropeptide signaling pathway 12204246;12204246 102 25:119, 185:191 KSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKL, AQVCGGD
PSQ02085 FND00197 Tachykinins Q9VGE8 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 23 neuropeptide hormone activity, neurotransmitter transmembrane transporter activity, signaling receptor binding, tachykinin receptor binding 289 dTk Tk 7227 extracellular space adult walking behavior, inter-male aggressive behavior, lipid metabolic process, neuropeptide signaling pathway, positive regulation of hindgut contraction, positive regulation of sensory perception of pain, response to pheromone, sensory perception of smell, tachykinin receptor signaling pathway 10801863 23 25:47 ADTETESSGSPLTPGAEEPRRVV
PSQ02086 FD00141 Protein spaetzle 5 Q9VZX1 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 255 growth factor activity, receptor ligand activity, Toll binding 387 Neurotrophic factor 2 , Protein spatzle 5 spz5 7227 extracellular region, extracellular space axon guidance, central nervous system formation, innate immune response, motor neuron axon guidance, nervous system development, positive regulation of antimicrobial peptide production, regulation of cell death, regulation of neuronal synaptic plasticity in response to neurotrophin, regulation of synaptic plasticity, regulation of Toll signaling pathway, Toll signaling pathway 23892553 255 30:284 HSSPPPCGLYGAPPCQFLPAPPGQTPTCARPGKTYCEHADNYPTYLIKSLVRKWGYEAATLLVDETWEDFAAVAWHDTPVFYDPKSIFPPRDPAAQDFNGYSYQTPFGGNPQRPSGGGNPLFVSNPSTEAPTYLLYTSSGGGHRSGHRYNSQGGGTSSSGGHLYINQSDKSTPYNATLWLKRLVRDLSRKQRQPDEVQAEVVEPVNEQTEEAEEQDNPAEDHPQSKRDVSLNMDLLDIVGVEAPNPLKKRSRTKR
PSQ02087 FD00029 Acidic phospholipase A2 2 Q9W7J3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) 8 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 154 Phosphatidylcholine 2-acylhydrolase, Pt-PLA2 None 8673 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 14678780 8 20:27 ARIPPLPL
PSQ02088 FD00010 Acidic phospholipase A2 1 Q9W7J4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) 8 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 154 Phosphatidylcholine 2-acylhydrolase, Pt-PLA1 None 8673 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 14678780 8 20:27 ARIPPLPL
PSQ02089 FD00564 Microcin J25 Q9X2V7 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 37 None 60 Class II lasso peptide , Ribosomally synthesized and post-translationally modified peptide mcjA 562 extracellular region cytolysis, defense response to bacterium 10092860 37 1:37 MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTK
PSQ02090 FD00544 Collagenase ColG Q9X721 Bacteria Firmicutes Clostridia Clostridiales Clostridiaceae Hathewaya Hathewaya histolytica (Clostridium histolyticum) 65 calcium ion binding, collagen binding, endopeptidase activity, metalloendopeptidase activity, serine-type endopeptidase activity, tripeptidase activity, zinc ion binding 1118 Class I collagenase , Gelatinase ColG , Microbial collagenase colG 1498 extracellular region collagen metabolic process, pathogenesis 9922257 65 46:110 KPIENTNDTSIKNVEKLRNAPNEENSKKVEDSKNDKVEHVKNIEEAKVEQVAPEVKSKSTLRSAS
PSQ02091 FD00412 Procardosin-A Q9XFX3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Carduoideae Cardueae Carduinae Cynara Cynara cardunculus (Cardoon) 44, 105 aspartic-type endopeptidase activity 504 None cardA 4265 cell wall, endoplasmic reticulum, extracellular region, membrane, protein storage vacuole lipid metabolic process 9692911;9692911 149 25:68, 310:414 VSDDGLIRIGLKKRKVDRIDQLRGRRALMEGNARKDFGFRGTVR, GVMNQQCKTVVSRYGRDIIEMLRSKIQPDKICSHMKLCTFDGARDVSSIIESVVDKNNDKSSGGIHDEMCTFCEMAVVWMQNEIKQSETEDNIINYANELCEHLS
PSQ02092 FD00487 Procardosin-B Q9XFX4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Carduoideae Cardueae Carduinae Cynara Cynara cardunculus (Cardoon) 46 aspartic-type endopeptidase activity 506 None cardB 4265 cell wall, endoplasmic reticulum, extracellular region, membrane, protein storage vacuole lipid metabolic process 8654427 46 25:70 VSNGGLLRVGLKKRKVDRLDQLRAHGVHMLGNARKDFGFRRTLSDS
PSQ02093 FD00502 Caspase Dronc Q9XYF4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 134 CARD domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, protein homodimerization activity 450 NEDD2-like caspase Dronc 7227 apoptosome, cytoplasm, nucleus, plasma membrane activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, central nervous system development, chaeta development, compound eye development, dendrite morphogenesis, determination of adult lifespan, ectopic germ cell programmed cell death, embryonic development via the syncytial blastoderm, execution phase of apoptosis, head involution, hemocyte development, melanization defense response, metamorphosis, negative regulation of cell population proliferation, neuron remodeling, nurse cell apoptotic process, positive regulation of apoptotic process, positive regulation of compound eye retinal cell programmed cell death, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of necrotic cell death, programmed cell death, programmed cell death involved in cell development, protein autoprocessing, regulation of autophagy, regulation of cell death, salivary gland histolysis, sperm individualization, zymogen activation 10200258 134 1:134 MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIV
PSQ02094 FND00322 Contulakin-G Q9XYR5 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium Conus geographus (Geography cone) (Nubecula geographus) 28 toxin activity 76 CGX-1160 None 6491 extracellular region None 10318778 28 23:50 GKLNDVIRGLVPDDITPQLILGSLISRR
PSQ02095 FD00003 Delta-conotoxin SVIE Q9XZK5 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus striatus (Striated cone) 29 sodium channel inhibitor activity, toxin activity 82 Omega-conotoxin SO-6, Omega-conotoxin-4 SO6 6493 extracellular region pathogenesis 11683628 29 23:51 DDSRYGLKNLFPKARHEMKNPEASKLNKR
PSQ02096 FND00232 BmK-YA precursor Q9Y0X6 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) 11, 56, 34, 34 opioid peptide activity, toxin activity 200 None None 34649 extracellular region None 22792309;22792309;22792309;22792309 135 24:34, 45:100, 111:144, 155:188 DKERQDWIPSD, SDEERQDWIPSDYGGHMNPAGRSDEERQDWIPSDYGGHMNPAGRSNEERQDWIPSD, SDEERQDWIPSDYGGHMNPAGRSNEERQDWIPSD, SDEERQDWIPSDYGGHMNPAGRSDEERQDWIPSD
PSQ02097 FD00448 Heparanase Q9Y251 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 48 beta-glucuronidase activity, heparanase activity, syndecan binding 543 Endo-glucoronidase, Heparanase-1 HPSE 9606 extracellular matrix, extracellular region, heparanase complex, intracellular membrane-bounded organelle, lysosomal lumen, lysosomal membrane, lysosome, membrane raft, nucleoplasm, nucleus, specific granule lumen angiogenesis involved in wound healing, cell-matrix adhesion, glycosaminoglycan catabolic process, heparan sulfate proteoglycan catabolic process, neutrophil degranulation, positive regulation of blood coagulation, positive regulation of hair follicle development, positive regulation of osteoblast proliferation, positive regulation of protein kinase B signaling, positive regulation of vascular endothelial growth factor production, proteoglycan metabolic process, regulation of hair follicle development, vascular wound healing 10395326, 10446189, 12713442 48 110:157 STFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQ
PSQ02098 FD00126 Beta-secretase 2 Q9Y5Z0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 42 aspartic-type endopeptidase activity 518 Aspartic-like protease 56 kDa, Aspartyl protease 1, Beta-site amyloid precursor protein cleaving enzyme 2, Down region aspartic protease, Memapsin-1, Membrane-associated aspartic protease 1, Theta-secretase BACE2 9606 dense core granule, endoplasmic reticulum, endosome, Golgi apparatus, integral component of membrane, membrane, plasma membrane, trans-Golgi network amyloid-beta metabolic process, astrocyte activation, glucose homeostasis, membrane protein ectodomain proteolysis, negative regulation of amyloid precursor protein biosynthetic process, peptide hormone processing, proteolysis 10591213, 11083922, 11423558, 16305800, 16816112 42 21:62 APELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLAL
PSQ02099 FD00500 Carboxypeptidase Q Q9Y646 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 24 carboxypeptidase activity, metal ion binding, metallodipeptidase activity, protein homodimerization activity 479 Lysosomal dipeptidase, Plasma glutamate carboxypeptidase CPQ 9606 cytoplasm, endoplasmic reticulum, extracellular exosome, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosome peptide catabolic process, proteolysis, thyroid hormone generation, tissue regeneration 10206990, 12675526 24 21:44 KAICKNGISKRTFEEIKEEIASCG
PSQ02100 FD00185 Tolloid-like protein 2 Q9Y6L7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 124 calcium ion binding, metalloendopeptidase activity, zinc ion binding 1020 None TLL2 9606 extracellular region cell differentiation, collagen fibril organization, extracellular matrix disassembly, multicellular organism development, negative regulation of skeletal muscle tissue growth 10479448 124 26:149 LGERPDATADYSELDGEEGTEQQLEHYHDPCKAAVFWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAGKDGRENTTLLHSPGTLHAAAKTFSPRVRR
Total Pages 43
Go to Lab Web Page