Details of PSQ02069
| ProSeqID |
PSQ02069 |
| Family |
FD00438 |
| Protein Name |
Apelin |
| UniProt ID |
Q9TUI9
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Ruminantia-Pecora-Bovidae-Bovinae-Bos |
| Organisms |
Bos taurus (Bovine) |
| Prosequence Length (aa) |
19 |
| Functions |
apelin receptor binding, hormone activity |
| Preproprotein Length (aa) |
77 |
| Alt Name |
APJ endogenous ligand |
| Gene Name |
APLN |
| NCBI ID |
9913 |
| Cellular Localization |
extracellular region, extracellular space |
| Processes |
angiogenesis, apelin receptor signaling pathway, coronary vasculature development, drinking behavior, gastrulation, negative regulation of blood pressure, positive regulation of G protein-coupled receptor internalization, positive regulation of heart contraction |
| PubMed |
9792798
|
| Total Prosequence Length (aa) |
19 |
| Prosequence Location |
23:41 |
| Prosequence Sequence |
GPLLQTSDGKEMEEGTIRY |
| Preproprotein Sequence |
MNLRRCVQALLLLWLCLSAVCGGPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |