Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01051 FD00328 Oncostatin-M P13725 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 31 cytokine activity, growth factor activity, oncostatin-M receptor binding 252 None OSM 9606 extracellular region, extracellular space cytokine-mediated signaling pathway, immune response, multicellular organism development, negative regulation of cell population proliferation, negative regulation of hormone secretion, oncostatin-M-mediated signaling pathway, positive regulation of acute inflammatory response, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of inflammatory response, positive regulation of interleukin-17 production, positive regulation of MAPK cascade, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of protein kinase B signaling, positive regulation of transcription by RNA polymerase II, positive regulation of tyrosine phosphorylation of STAT protein, regulation of growth, regulation of hematopoietic stem cell differentiation 2325640 31 222:252 HSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
PSQ01052 FD00148 Bone marrow proteoglycan P13727 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 89 carbohydrate binding, extracellular matrix structural constituent conferring compression resistance, heparin binding 222 Proteoglycan 2 PRG2 9606 collagen-containing extracellular matrix, extracellular exosome, extracellular region, ficolin-1-rich granule lumen, transport vesicle defense response to bacterium, neutrophil degranulation 2501794, 3410852 89 17:105 LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQ
PSQ01053 FD00590 Endoglucanase 1 P13933 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces sp 200 cellulase activity 360 CMCase I, Carboxymethyl cellulase, Cellulase, Endo-1 casA 74575 None cellulose catabolic process 3410319 200 70:269 AGTTALPSMELYRAEAGVHAWLDANPGDHRAPLIAERIGSQPQAVWFAGAYNPGTITQQVAEVTSAAAAAGQLPVVVPYMIPFRDCGNHSGGGAPSFAAYAEWSGLFAAGLGSEPVVVVLEPDAIPLIDCLDNQQRAERLAALAGLAEAVTDANPEARVYYDVGHSAWHAPAAIAPTLVEAGILEHGAGIATNISNYRTT
PSQ01054 FD00547 CD59 glycoprotein P13987 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 26 complement binding 128 1F5 antigen, 20 kDa homologous restriction factor, MAC-inhibitory protein, MEM43 antigen, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, Protectin CD59 9606 anchored component of external side of plasma membrane, cell surface, endoplasmic reticulum membrane, endoplasmic reticulum-Golgi intermediate compartment membrane, ER to Golgi transport vesicle membrane, extracellular exosome, extracellular space, focal adhesion, Golgi membrane, membrane, plasma membrane, specific granule membrane, tertiary granule membrane, transport vesicle, vesicle blood coagulation, cell surface receptor signaling pathway, COPII vesicle coating, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of activation of membrane attack complex, neutrophil degranulation, regulation of complement activation, regulation of complement-dependent cytotoxicity 9054419 26 103:128 GGTSLSEKTVLLLVTPFLAAAWSLHP
PSQ01055 FD00012 Chymopapain P14080 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Caricaceae Carica Carica papaya (Papaya) 116 cysteine-type peptidase activity 359 Papaya proteinase II None 3649 None None 2106878, 2500950 116 19:134 IHMGLSSADFYTVGYSQDDLTSIERLIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTN
PSQ01056 FD00204 Cathepsin E P14091 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 34 aspartic-type endopeptidase activity, identical protein binding, peptidase activity 396 None CTSE 9606 endosome antigen processing and presentation of exogenous peptide antigen via MHC class II, protein autoprocessing, proteolysis 2334440, 8346912 34 20:53 SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDM
PSQ01057 FD00434 Endoglucanase 3 P14250 Bacteria Fibrobacteres Fibrobacterales Fibrobacteraceae Fibrobacter Fibrobacter succinogenes (strain ATCC 19169 242 cellulase activity 660 Cellulase 3, Endo-1 cel-3 59374 membrane cellulose catabolic process 2676979 242 24:265 CGDENTQALFANNPVPGAENQVPVSSSDMSPTSSDAVIDPTSSSAAVVDPSTLPAEGPITMPEGLGTLVDDFEDGDNLSKIGDYWYTYNDNDNGGASIITTPLNEEENIIPGRVNNGSNYALQVNYTLDRGDYEYDPYVGWGVQVAPDEANGHFGGLTYWYKGGAHEVHIEITDVEDYDVHLAKFPASRTWKQAVVRFKDLVQGGWGKEIPFDAKHIMAISFQAKGNKSKLVTDSLFIDNIY
PSQ01058 FD00163 Pectinesterase 1 P14280 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 190 aspartyl esterase activity, pectinesterase activity, pectinesterase inhibitor activity 546 Pectin methylesterase 1 PME1 4081 cell wall, extracellular region cell wall modification, fruit ripening, pectin catabolic process 3732279 190 40:229 YQVEIKHSNLCKTAQDSQLCLSYVSDLISNEIVTTESDGHSILMKFLVNYVHQMNNAIPVVRKMKNQINDIRQHGALTDCLELLDQSVDFASDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDSFTKAMINGTNLEELISRAKVALAMLASLTTQDEDVFMTVLGKMPSWVSSMDRKLMESSGKD
PSQ01059 FND00282 Delta-hormotoxin-Cpt1b P14531 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Nynantheae Hormathiidae Calliactis Calliactis parasitica (Sea anemone) (Actinia parasitica) 11 toxin activity 79 Calitoxin , Calitoxin-1 , Neurotoxic peptide None 6114 extracellular region, nematocyst None 2567180 11 21:31 RTTLNKRNDIE
PSQ01060 FD00401 Fibronectin-binding protein A P14738 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus (strain NCTC 8325 33 fibrinogen binding, fibronectin binding 1020 None fnbA 93061 cell wall, extracellular region aggregation of unicellular organisms, cell adhesion, pathogenesis 11830639, 14769030 33 986:1018 GGEESTNKGMLFGGLFSILGLALLRRNKKNHKA
PSQ01061 FD00040 Elastase P14756 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 174 endopeptidase activity, metal ion binding, metalloendopeptidase activity 498 Neutral metalloproteinase, PAE , Pseudolysin lasB 208964 extracellular region bacterial-type flagellum-dependent swarming motility, pathogenesis, protein secretion by the type II secretion system, protein transport by the Sec complex, proteolysis, single-species biofilm formation 1544509, 2123831, 3034864, 9642203 174 24:197 ADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAH
PSQ01062 FD00563 Protease LasA P14789 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 205 endopeptidase activity, metal ion binding, metalloendopeptidase activity 420 Staphylolytic protease lasA 208964 extracellular space pathogenesis, peptidoglycan catabolic process, protein secretion by the type II secretion system, protein transport by the Sec complex, proteolysis, septum digestion after cytokinesis 2110137, 9642203 205 32:236 HDDGLPAFRYSAELLGQLQLPSVALPLNDDLFLYGRDAEAFDLEAYLALNAPALRDKSEYLEHWSGYYSINPKVLLTLMVMQSGPLGAPDERALAAPLGRLSAKRGFDAQVRDVLQQLSRRYYGFEEYQLRQAAARKAVGEDGLNAASAALLGLLREGAKVSAVQGGNPLGAYAQTFQRLFGTPAAELLQPSNRVARQLQAKAAL
PSQ01063 FD00045 Concanavalin-A P14894 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Canavalia Canavalia gladiata (Sword bean) (Dolichos gladiatus) 15 mannose binding, metal ion binding, monosaccharide binding 290 None None 3824 None negative regulation of transcription, DNA-templated, positive regulation of cell division, positive regulation of mitotic nuclear division, regulation of defense response to virus 15935326 15 149:163 VIRNSTTIDFNAAYN
PSQ01064 FD00205 Mast cell carboxypeptidase A P15088 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 94 metallocarboxypeptidase activity, zinc ion binding 420 Carboxypeptidase A3 CPA3 9606 collagen-containing extracellular matrix, extracellular region, extracellular space, secretory granule, transport vesicle angiotensin maturation, proteolysis 2708524 94 16:109 IAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKED
PSQ01065 FD00319 LIRP P15131 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Polyneoptera Orthoptera Caelifera Acrididea Acridomorpha Acridoidea Acrididae Oedipodinae Locusta Locusta migratoria (Migratory locust) 14, 6 hormone activity 145 Locusta insulin-related peptide None 7004 extracellular region None 1935945;1935945 20 20:33, 117:122 TQAQSDLFLLSPKR, FRRRTR
PSQ01066 FD00058 Snake venom metalloproteinase atrolysin-D P15167 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus Crotalus atrox (Western diamondback rattlesnake) 170 metal ion binding, metalloendopeptidase activity, toxin activity 420 Hemorrhagic metalloproteinase atrolysin D, Hemorrhagic toxin D None 8730 extracellular region collagen catabolic process 2745407 170 21:190 IILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYELKVNGEPVVLHLEKNKELFSKDYSETHYSPDGRKITTNPSVEDHCYYRGRIENDADSTASISACNGLKGHFKLQGEMYLIEPLELSDSEAHAVFKLENVEKEDEAPKMCGVTQNWESYEPIKKASDLNLNPD
PSQ01067 FD00333 PIII-type proteinase P15292 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 154 serine-type endopeptidase activity 1962 Cell wall-associated serine proteinase, Lactocepin prtP 272622 cell wall, extracellular region, membrane None 2760036 154 34:187 AISQQTKGSSLANTVTAATAKQAATDTTAATTNQAIATQLAAKGIDYNKLNKVQQQDIYVDVIVQMSAAPASENGTLRTDYSSTAEIQQETNKVIAAQASVKAAVEQVTQQTAGESYGYVVNGFSTKVRVVDIPKLKQIAGVKTVTLAKVYYPT
PSQ01068 FD00436 Allergen Sin a 1 P15322 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Brassiceae Sinapis Sinapis alba (White mustard) (Brassica hirta) 15 nutrient reservoir activity 145 Allergen Sin a I None 3728 None None 3181153 15 40:54 WTLDDEFDFEDDMEN
PSQ01069 FD00305 Scytalidopepsin B P15369 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Leotiomycetes Leotiomycetes incertae sedis Scytalidium Scytalidium lignicola (Hyphomycete) 34 aspartic-type endopeptidase activity 260 Acid protease B None 5539 None None 6370989 34 21:54 APGGNGFARRQARRQARAAGLKASPFRQVNAKEA
PSQ01070 FD00028 2S seed storage protein 1 P15457 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 16, 10 nutrient reservoir activity 164 2S albumin storage protein, NWMU2-2S albumin 1 AT2S1 3702 None None 16666238;16666238 26 22:37, 74:83 SIYRTVVEFEEDDATN, EFDFEDDMEN
PSQ01071 FD00006 Alpha-conotoxin SI P15471 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus striatus (Striated cone) 28 acetylcholine receptor inhibitor activity, toxin activity 64 None None 6493 extracellular region, host cell postsynaptic membrane pathogenesis 3196703 28 22:49 FPSDRASDGRDDEAKDERSDMHESDRKE
PSQ01072 FD00112 Globulin-1 S allele P15590 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Tripsacinae Zea Zea mays (Maize) 68 nutrient reservoir activity 573 7S-like GLB1 4577 None None 2775172 68 19:86 AVASSWEDDNHHHHGGHKSGRCVRRCEDRPWHQRPRCLEQCREEEREKRQERSRHEADDRSGEGSSED
PSQ01073 FD00505 Protease 1 P15636 Bacteria Proteobacteria Betaproteobacteria Burkholderiales Alcaligenaceae Achromobacter Achromobacter lyticus 185 serine-type endopeptidase activity 660 API, Lysyl endopeptidase, Protease I None 224 extracellular region None 2492988 185 21:205 APASRPAAFDYANLSSVDKVALRTMPAVDVAKAKAEDLQRDKRGDIPRFALAIDVDMTPQNSGAWEYTADGQFAVWRQRVRSEKALSLNFGFTDYYMPAGGRLLVYPATQAPAGDRGLISQYDASNNNSARQLWTAVVPGAEAVIEAVIPRDKVGEFKLRLTKVNHDYVGFGPLARRLAAASGEK
PSQ01074 FD00360 Photosystem II reaction center protein K P15819 Bacteria Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp 8 None 45 None psbK 1111708 integral component of membrane, photosystem II reaction center, plasma membrane-derived thylakoid membrane, plasma membrane-derived thylakoid photosystem II photosynthesis 12069591, 1904061 8 1:8 METIYLLA
PSQ01075 FD00007 Kallikrein-1 P15947 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 6 endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity 261 Glandular kallikrein K1, KAL-B, Renal kallikrein, Tissue kallikrein-6 Klk1 10090 extracellular space, protein-containing complex, secretory granule regulation of systemic arterial blood pressure, zymogen activation 1639762 6 19:24 PPVQSR
PSQ01076 FD00007 Kallikrein 1-related peptidase b22 P15948 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 7 endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, peptidase activity, serine-type endopeptidase activity 259 Beta-NGF-endopeptidase, Epidermal growth factor-binding protein type A, Glandular kallikrein K22, Nerve growth factor beta chain endopeptidase, Tissue kallikrein 22 Klk1b22 10090 extracellular space, protein-containing complex, secretory granule regulation of systemic arterial blood pressure, zymogen activation 1639762, 2012805 7 18:24 APPVQSR
PSQ01077 FND00261 Omega-agatoxin-1A P15969 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelenopsis Agelenopsis aperta (North American funnel-web spider) (Agelenopsis, gertschi) 17 toxin activity 119 Omega-agatoxin IA None 6908 extracellular region pathogenesis 2295621 17 20:36 VEGEEEYFEAEVPELER
PSQ01078 FD00149 Photosystem II protein D1 2 P16033 Bacteria Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp 16 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, iron ion binding, oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor, oxygen evolving activity 360 Photosystem II Q(B) protein 2 psbA2 , psbA3 1111708 integral component of membrane, photosystem II, plasma membrane-derived thylakoid membrane, plasma membrane-derived thylakoid photosystem II photosynthetic electron transport in photosystem II, protein-chromophore linkage, response to herbicide 8034700 16 345:360 SGEQAPVALTAPAVNG
PSQ01079 FD00004 Trypsin-1 P16049 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Zeiogadaria Gadariae Gadiformes Gadoidei Gadidae Gadus Gadus morhua (Atlantic cod) 6 serine-type endopeptidase activity 241 Trypsin I None 8049 extracellular space digestion 2707266 6 14:19 FAEEDK
PSQ01080 FD00184 Sodium/potassium ATPase inhibitor SPAI-2 P16225 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 105 serine-type endopeptidase inhibitor activity 187 Protein WAP-2 None 9823 extracellular space antibacterial humoral response, copulation, innate immune response 2553020 105 22:126 QRLDRIRGPKGQGQDPVEGQDQDEGPGPVKVEILDIGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKSQDPVKAELPDIGQDVVKGHEPVEGQDPVNAQLPDKVQD
PSQ01081 FD00043 Cathepsin E P16228 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 37 aspartic-type endopeptidase activity, identical protein binding, peptidase activity 398 None Ctse 10116 endosome antigen processing and presentation of exogenous peptide antigen via MHC class II, protein autoprocessing, proteolysis 2105725 37 22:58 VLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDMIEF
PSQ01082 FD00061 Cionin P16240 Eukaryota Metazoa Chordata Tunicata Ascidiacea Phlebobranchia Cionidae Ciona Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) 86 hormone activity 128 None None 7719 extracellular region neuropeptide signaling pathway 2303439 86 23:108 PASDLFKSVSQYHIPRSKVINKETVTKPLQFQRAICRLLQKLGEETFARLSQSELEAKQLDLIKTCYQANSFGDNENQGHMQRMDR
PSQ01083 FD00078 Peptidase 1 P16311 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Acariformes Sarcoptiformes Astigmata Psoroptidia Analgoidea Pyroglyphidae Dermatophagoidinae Dermatophagoides Dermatophagoides farinae (American house dust mite) 80 cysteine-type peptidase activity 321 Allergen Der f I, Major mite fecal allergen Der f 1 DERF1 6954 extracellular region None 3372999 80 19:98 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAE
PSQ01084 FD00394 Dipeptidase 1 P16444 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 26 beta-lactamase activity, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, GPI anchor binding, metallodipeptidase activity, metalloexopeptidase activity, modified amino acid binding, zinc ion binding 418 Beta-lactamase , Dehydropeptidase-I, Microsomal dipeptidase , Renal dipeptidase DPEP1 9606 anchored component of membrane, apical part of cell, apical plasma membrane, cell junction, extracellular exosome, extracellular space, microvillus membrane, nucleoplasm, plasma membrane aflatoxin metabolic process, antibiotic metabolic process, cellular lactam catabolic process, cellular response to calcium ion, cellular response to drug, cellular response to nitric oxide, glutathione catabolic process, glutathione metabolic process, homocysteine metabolic process, inflammatory response, leukotriene metabolic process, lipid metabolic process, negative regulation of apoptotic process, negative regulation of cell migration, negative regulation of cysteine-type endopeptidase activity involved in apoptotic process, negative regulation of inflammatory response to antigenic stimulus, neutrophil chemotaxis 2168407 26 386:411 GASSLHRHWGLLLASLAPLVLCLSLL
PSQ01085 FD00322 Protein-lysine 6-oxidase P16636 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 141 collagen binding, copper ion binding, protein-lysine 6-oxidase activity 418 Lysyl oxidase Lox 10116 collagen trimer, extracellular matrix, extracellular region, extracellular space, nucleus aorta development, ascending aorta development, blood vessel development, blood vessel morphogenesis, bone mineralization, cell chemotaxis, cellular response to chemokine, cellular response to organic substance, collagen fibril organization, connective tissue development, descending aorta development, DNA biosynthetic process, elastic fiber assembly, heart development, lung development, muscle cell cellular homeostasis, muscle fiber development, osteoblast differentiation, peptidyl-lysine oxidation, platelet-derived growth factor receptor-beta signaling pathway, protein kinase B signaling, protein oxidation, regulation of apoptotic process, regulation of bone development, regulation of gene expression, regulation of megakaryocyte differentiation, regulation of platelet-derived growth factor receptor-beta signaling pathway, regulation of protein phosphorylation, regulation of receptor binding, regulation of striated muscle tissue development, regulation of transforming growth factor beta receptor signaling pathway, response to drug, response to hormone, response to steroid hormone, wound healing 8636146 141 22:162 APQAPREPPAAPGAWRQTIQWENNGQVFSLLSLGAQYQPQRRRDSSATAPRADGNAAAQPRTPILLLRDNRTASARARTPSPSGVAAGRPRPAARHWFQVGFSPSGAGDGASRRAANRTASPQPPQLSNLRPPSHVDRMVG
PSQ01086 FD00340 Uteroferrin-associated protein P16708 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 15 serine-type endopeptidase inhibitor activity 420 None None 9823 extracellular space female pregnancy, negative regulation of endopeptidase activity 2342477 15 26:40 EKQQTSPKTITPVSF
PSQ01087 FD00263 Major core protein 4a precursor P16715 Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain, WR)) 83 structural molecule activity 898 Virion core protein 4a precursor None 10254 virion None 1853556 83 615:697 SPEGEETIICDSEPISILDRIDTRGIFSAYTINEMMDTDIFSPENKAFKNNLSRFIESGDITGEDIFCAMPYNILDRIITNAG
PSQ01088 FND00242 KP6 killer toxin P16948 Viruses Riboviria Orthornavirae Duplornaviricota Chrymotiviricetes Ghabrivirales Totiviridae Totivirus Ustilago maydis P6 virus (UmV6) (UmV-P6) 8, 33 toxin activity 219 Killer protein 6 None 11010 extracellular region None 2181272;2181272 41 20:27, 106:138 LPNGLSPR, KRTIQDSATDTVDLGAELHRDDPPPTASDIGKR
PSQ01089 FD00353 Thermopsin P17118 Archaea Crenarchaeota Thermoprotei Sulfolobales Sulfolobaceae Sulfolobus Sulfolobus acidocaldarius (strain ATCC 33909 , 15157 13 aspartic-type endopeptidase activity 340 None thpS 330779 extracellular region None 2104843 13 29:41 HRNTTGATISSGL
PSQ01090 FD00015 Zinc metalloproteinase P17349 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) 16 metal ion binding, metalloendopeptidase activity, toxin activity 481 None None 88086 extracellular region None 2191722, 8920980 16 393:408 LRTDTVSTPVSGNEFL
PSQ01091 FD00031 Defensin-1 P17722 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis Apis mellifera (Honeybee) 24 None 95 Royalisin None 7460 extracellular region defense response to bacterium, innate immune response 2358464 24 20:43 APVEDEFEPLEHFENEERADRHRR
PSQ01092 FD00231 Mu-ctenitoxin-Pn1a P17727 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 14 toxin activity 119 Toxin Tx1 None 6918 extracellular region pathogenesis 16278100, 16505156, 1801316, 2335228 14 20:33 EEMIEGENPLEDQR
PSQ01093 FD00293 SpoIVB peptidase P17896 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 24 serine-type peptidase activity 426 Sporulation factor IV B protease, Stage IV sporulation protein B spoIVB 224308 None sporulation resulting in formation of a cellular spore 10931284 24 29:52 YLLIPTQMRVFETQTQAIETSLSV
PSQ01094 FD00339 Ganglioside GM2 activator P17900 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 8 beta-N-acetylgalactosaminidase activity, lipid transporter activity, phospholipase activator activity 193 Cerebroside sulfate activator protein, GM2-AP, Sphingolipid activator protein 3 GM2A 9606 apical plasma membrane, azurophil granule lumen, basolateral plasma membrane, cytoplasmic side of plasma membrane, cytosol, extracellular exosome, extracellular region, intracellular membrane-bounded organelle, lysosomal lumen ganglioside catabolic process, glycosphingolipid metabolic process, learning or memory, lipid storage, lipid transport, neuromuscular process controlling balance, neutrophil degranulation, oligosaccharide catabolic process, positive regulation of hydrolase activity 2209618 8 24:31 HLKKPSQL
PSQ01095 FD00030 Aspergillopepsin-1 P17946 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus awamori (Black koji mold) 49 aspartic-type endopeptidase activity 394 Aspartic protease pepA, Aspergillopepsin A , Aspergillopepsin I, Aspergillopeptidase A pepA 105351 extracellular region None 2182390 49 21:69 APAPTRKGFTINQIARPANKTRTINLPGMYARSLAKFGGTVPQSVKEAA
PSQ01096 FD00535 Bone morphogenetic protein 7 P18075 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 263 BMP receptor binding, cytokine activity, growth factor activity, heparin binding 431 Osteogenic protein 1 BMP7 9606 collagen-containing extracellular matrix, extracellular region, extracellular space, vesicle allantois development, axon guidance, BMP signaling pathway, branching involved in salivary gland morphogenesis, branching morphogenesis of an epithelial tube, cardiac muscle tissue development, cardiac septum morphogenesis, cartilage development, cellular response to BMP stimulus, cellular response to hypoxia, chorio-allantoic fusion, dendrite development, embryonic camera-type eye morphogenesis, embryonic limb morphogenesis, embryonic pattern specification, embryonic skeletal joint morphogenesis, endocardial cushion formation, epithelial cell differentiation, epithelial to mesenchymal transition, heart trabecula morphogenesis, hindbrain development, mesenchymal cell differentiation, mesenchyme development, mesoderm formation, mesonephros development, metanephric mesenchymal cell proliferation involved in metanephros development, metanephric mesenchyme morphogenesis, metanephros development, monocyte aggregation, negative regulation of cell cycle, negative regulation of cell death, negative regulation of glomerular mesangial cell proliferation, negative regulation of MAP kinase activity, negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis, negative regulation of mitotic nuclear division, negative regulation of neurogenesis, negative regulation of neuron differentiation, negative regulation of NF-kappaB transcription factor activity, negative regulation of NIK/NF-kappaB signaling, negative regulation of Notch signaling pathway, negative regulation of phosphorylation, negative regulation of prostatic bud formation, negative regulation of striated muscle cell apoptotic process, negative regulation of transcription, DNA-templated, nephrogenic mesenchyme morphogenesis, neural fold elevation formation, neuron projection morphogenesis, odontogenesis of dentin-containing tooth, ossification, pericardium morphogenesis, pharyngeal system development, positive regulation of apoptotic process, positive regulation of bone mineralization, positive regulation of brown fat cell differentiation, positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis, positive regulation of dendrite development, positive regulation of epithelial to mesenchymal transition, positive regulation of gene expression, positive regulation of heterotypic cell-cell adhesion, positive regulation of hyaluranon cable assembly, positive regulation of neuron differentiation, positive regulation of osteoblast differentiation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, protein localization to nucleus, regulation of branching involved in prostate gland morphogenesis, regulation of pathway-restricted SMAD protein phosphorylation, regulation of removal of superoxide radicals, response to estradiol, response to peptide hormone, response to vitamin D, skeletal system development, SMAD protein signal transduction, steroid hormone mediated signaling pathway, ureteric bud development 17977014 263 30:292 DFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIR
PSQ01097 FD00037 C-type natriuretic peptide P18104 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 50 hormone activity, hormone receptor binding, signaling receptor binding 126 None NPPC 9823 extracellular region, protein-containing complex cGMP biosynthetic process, growth plate cartilage chondrocyte differentiation, growth plate cartilage chondrocyte proliferation, negative regulation of meiotic cell cycle, negative regulation of oocyte maturation, ossification, post-embryonic development, protein folding, receptor guanylyl cyclase signaling pathway, regulation of multicellular organism growth, reproductive process 2383278 50 24:73 KPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGGGANLKGDRSRLLR
PSQ01098 FD00037 C-type natriuretic peptide P18145 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Anguilliformes Anguillidae Anguilla Anguilla japonica (Japanese eel) 89 hormone activity 131 BNP-like peptide CNP-22 cnp 7937 extracellular region cGMP biosynthetic process, receptor guanylyl cyclase signaling pathway 2143379 89 21:109 DSRALRTPVDAIQFVEQFLEHYNDLLNIDDLENQTGDQLESPQPLSSGLKVAEYPKWVDVPSQNDNTWFRLLRGALANRKRALPDRAKR
PSQ01099 FD00072 Photosystem II reaction center protein K P18263 Eukaryota Viridiplantae Chlorophyta core chlorophytes Chlorophyceae Chlamydomonadales Chlamydomonadaceae Chlamydomonas Chlamydomonas reinhardtii (Chlamydomonas smithii) 9 None 46 None psbK 3055 chloroplast thylakoid membrane, integral component of membrane, photosystem II reaction center photosynthesis 1885590 9 1:9 MTTLALVLA
PSQ01100 FD00031 Sapecin P18313 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Oestroidea Sarcophagidae Sarcophaga Boettcherisca Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina) 31 None 94 None None 7386 extracellular region defense response to bacterium, innate immune response 3182836 31 24:54 SPAAAAEESKFVDGLHALKTIEPELHGRYKR
Total Pages 43
Go to Lab Web Page