Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00701 FD00110 Bowman-Birk type proteinase inhibitor C-II P01063 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 7 serine-type endopeptidase inhibitor activity 83 None None 3847 extracellular region None 599141 7 1:7 MELNLFK
PSQ00702 FD00110 Bowman-Birk type proteinase inhibitor D-II P01064 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 8 serine-type endopeptidase inhibitor activity 83 IV None 3847 extracellular region None 641033 8 1:8 MCILSFLK
PSQ00703 FD00519 2S albumin P01089 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Euphorbiaceae Acalyphoideae Acalypheae Ricinus Ricinus communis (Castor bean) 10 nutrient reservoir activity 258 None None 3988 None None 9430499 10 77:86 EVLRMPGDEN
PSQ00704 FD00109 Beta-nerve growth factor P01139 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 103 cysteine-type endopeptidase activator activity involved in apoptotic process, death receptor agonist activity, growth factor activity, lipid binding, metalloendopeptidase inhibitor activity, nerve growth factor receptor binding, transmembrane receptor protein tyrosine kinase activator activity 241 None Ngf 10090 axon, dendrite, endoplasmic reticulum lumen, endosome lumen, extracellular region, extracellular space, neuron projection terminus, synaptic vesicle activation of cysteine-type endopeptidase activity involved in apoptotic process, adult locomotory behavior, circadian rhythm, extrinsic apoptotic signaling pathway in absence of ligand, extrinsic apoptotic signaling pathway via death domain receptors, memory, modulation of chemical synaptic transmission, negative regulation of neuron apoptotic process, negative regulation of type B pancreatic cell apoptotic process, nerve development, nerve growth factor signaling pathway, neuron apoptotic process, neuron development, neuron projection development, neuron projection morphogenesis, peripheral nervous system development, positive regulation of axon extension, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of collateral sprouting, positive regulation of DNA binding, positive regulation of DNA-binding transcription factor activity, positive regulation of ERK1 and ERK2 cascade, positive regulation of gene expression, positive regulation of neuron differentiation, positive regulation of neuron maturation, positive regulation of neuron projection development, positive regulation of neurotrophin TRK receptor signaling pathway, positive regulation of peptidyl-serine phosphorylation, positive regulation of protein autophosphorylation, positive regulation of protein binding, positive regulation of protein phosphorylation, positive regulation of protein ubiquitination, positive regulation of Ras protein signal transduction, positive regulation of stem cell proliferation, regulation of neuron differentiation, regulation of neurotransmitter secretion, regulation of release of sequestered calcium ion into cytosol, sensory perception of pain, transmembrane receptor protein tyrosine kinase signaling pathway 20036257, 4566923 103 19:121 EPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKR
PSQ00705 FD00497 Corticoliberin P01142 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis Ovis aries (Sheep) 123 hormone activity 190 Corticotropin-releasing factor, Corticotropin-releasing hormone, Endorpholiberin CRH 9940 extracellular region, synapse regulation of NMDA receptor activity, synaptic transmission, dopaminergic 2647152, 6267699, 6273874 123 25:147 LLSRGPIPGARQASQHPQPLSFFQPLPQPQEPQALPTLLRVGEEYFLRLGNLDETRAAPLSPAASPLASRSSSRLSPDKVAANFFRALLQPRRPLDSPAGPAKRGTENALGSRQEAPAARKRR
PSQ00706 FD00052 Corticoliberin P01143 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 120 corticotropin-releasing hormone activity, corticotropin-releasing hormone receptor 1 binding, corticotropin-releasing hormone receptor 2 binding 187 Corticotropin-releasing factor, Corticotropin-releasing hormone Crh 10116 cytoplasm, extracellular space, neuronal cell body, perikaryon, synapse, varicosity adrenal gland development, associative learning, cellular response to cocaine, cellular response to dexamethasone stimulus, diterpenoid metabolic process, female pregnancy, glucocorticoid biosynthetic process, hormone-mediated apoptotic signaling pathway, hypothalamus development, inflammatory response, ion homeostasis, learning or memory, locomotory exploration behavior, long-term synaptic potentiation, lung development, negative regulation of cell death, negative regulation of epinephrine secretion, negative regulation of gene expression, negative regulation of glucagon secretion, negative regulation of luteinizing hormone secretion, negative regulation of norepinephrine secretion, negative regulation of systemic arterial blood pressure, positive regulation of behavioral fear response, positive regulation of calcium ion import, positive regulation of cAMP-mediated signaling, positive regulation of cell death, positive regulation of cell population proliferation, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of digestive system process, positive regulation of gene expression, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of protein phosphorylation, regulation of NMDA receptor activity, regulation of serotonin secretion, response to cocaine, response to corticosterone, response to drug, response to estrogen, response to ethanol, response to ether, response to immobilization stress, response to pain, steroid metabolic process, synaptic transmission, dopaminergic 6603620 120 25:144 LLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALERERR
PSQ00707 FD00105 Somatostatin P01168 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 64 hormone activity 120 None SST 9823 extracellular space regulation of cell migration 6107906, 7353633 64 25:88 APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQR
PSQ00708 FD00105 Somatostatin-2 P01170 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Lophiiformes Lophiidae Lophius Lophius americanus (American angler) (Anglerfish) 73 hormone activity 125 Somatostatin II sst2 8073 extracellular region None 2857489 73 25:97 QLDREQSDNQDLDLELRQHWLLERARSAGLLSQEWSKRAVEELLAQMSLPEADVQREAEDASMATGGRMNLER
PSQ00709 FD00374 Parathyroid hormone P01268 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 6 hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding 120 Parathyrin PTH 9913 extracellular space cell-cell signaling, cellular calcium ion homeostasis, positive regulation of glucose import, positive regulation of glycogen biosynthetic process 5275384, 5531031 6 26:31 KSVKKR
PSQ00710 FD00165 Parathyroid hormone P01269 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 6 hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, type 1 parathyroid hormone receptor binding 120 Parathyrin PTH 9823 extracellular space activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, homeostasis of number of cells within a tissue, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of gene expression, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II 4840833 6 26:31 KPIKKR
PSQ00711 FD00165 Parathyroid hormone P01270 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, receptor ligand activity, type 1 parathyroid hormone receptor binding 120 Parathormone, Parathyrin PTH 9606 extracellular region, extracellular space activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, bone resorption, cAMP metabolic process, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, G protein-coupled receptor signaling pathway, homeostasis of number of cells within a tissue, hormone-mediated apoptotic signaling pathway, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of bone mineralization involved in bone maturation, negative regulation of chondrocyte differentiation, negative regulation of gene expression, negative regulation of inflammatory response to antigenic stimulus, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II, regulation of gene expression, response to cadmium ion, response to drug, response to ethanol, response to fibroblast growth factor, response to lead ion, response to parathyroid hormone, response to vitamin D, Rho protein signal transduction, skeletal system development 4521809 6 26:31 KSVKKR
PSQ00712 FD00432 Pro-glucagon P01275 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 glucagon receptor binding, hormone activity, identical protein binding, signaling receptor binding 180 None GCG 9606 endoplasmic reticulum lumen, extracellular region, extracellular space, secretory granule lumen adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to glucagon stimulus, feeding behavior, G protein-coupled receptor signaling pathway, glucose homeostasis, negative regulation of apoptotic process, negative regulation of execution phase of apoptosis, negative regulation of inflammatory response to antigenic stimulus, positive regulation of calcium ion import, positive regulation of ERK1 and ERK2 cascade, positive regulation of gluconeogenesis, positive regulation of histone H3-K4 methylation, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of protein binding, positive regulation of protein kinase activity, protein kinase A signaling, regulation of insulin secretion, response to activity 2753890 6 84:89 NRNNIA
PSQ00713 FD00096 Somatoliberin P01286 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding 108 Growth hormone-releasing factor, Growth hormone-releasing hormone, Somatocrinin, Somatorelin GHRH 9606 extracellular region, extracellular space, perikaryon, terminal bouton adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, G protein-coupled receptor signaling pathway, growth hormone secretion, negative regulation of inflammatory response to antigenic stimulus, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, REM sleep, positive regulation of growth hormone secretion, positive regulation of insulin-like growth factor receptor signaling pathway, positive regulation of multicellular organism growth, response to food 6812220 11 21:31 PPPPLTLRMRR
PSQ00714 FND00092 Gastrin P01353 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Carnivora Caniformia Canidae Canis Canis lupus familiaris (Dog) (Canis familiaris) 37 hormone activity 104 None GAST 9615 extracellular space G protein-coupled receptor signaling pathway, response to food 3763441 37 22:58 SWKPRSRLQDAPSGPGANRGLEPHGLDQLGPASHHRR
PSQ00715 FD00055 Preprocaerulein type-4 P01357 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 46, 51, 51 hormone activity 240 Preprocaerulein type IV None 8355 extracellular region defense response 5413288;5413288;5413288 148 27:72, 101:151, 165:215 DEERDVRGLASLLGKALKATLKIGTHFLGGAPQQREANDERRFADG, DDEDDVHERDVRGFGSFLGKALKAALKIGANALGGAPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00716 FD00016 Corticostatin-3 P01376 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 43 None 95 Antiadrenocorticotropin peptide III, Corticostatin III, Macrophage antibiotic peptide MCP-1 None 9986 extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, defense response to bacterium, defense response to fungus, defense response to virus, killing of cells of other organism 1311240, 3988726, 6643497 43 20:62 EHVSVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAG
PSQ00717 FD00016 Corticostatin-4 P01377 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 43 None 95 Antiadrenocorticotropin peptide IV, Corticostatin IV, Macrophage antibiotic peptide MCP-2 None 9986 extracellular space defense response to bacterium, defense response to fungus, defense response to virus, killing of cells of other organism 1311240, 3988726, 6643497 43 20:62 EHISVSIDEVVDQQPPQAEDQDVAIYVKEHESSALEALGVKAG
PSQ00718 FD00576 Melittin P01501 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis Apis mellifera (Honeybee) 22 porin activity, protein kinase inhibitor activity, toxin activity 70 Allergen Api m 3 , Allergen Api m III MELT 7460 extracellular region, other organism cell membrane, pore complex hemolysis in other organism, ion transport 20403370, 20472009, 5592400 22 22:43 APEPEPAPEPEAEADAEADPEA
PSQ00719 FD00211 Attacin-E P01513 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Saturniidae Saturniinae Attacini Hyalophora Hyalophora cecropia (Cecropia moth) 28 None 240 Immune protein P5 None 7123 extracellular region defense response to bacterium, innate immune response 16453547 28 20:47 RYLIVSEPVYYIEHYEEPELLASSRVRR
PSQ00720 FD00003 Omega-conotoxin GVIA P01522 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium Conus geographus (Geography cone) (Nubecula geographus) 23 ion channel inhibitor activity, toxin activity 73 SNX-124, Shaker peptide None 6491 extracellular region pathogenesis 4071055, 6509012 23 23:45 DDSRGTQKHRALGSTTELSLSTR
PSQ00721 FD00003 Mu-conotoxin GIIIA P01523 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium Conus geographus (Geography cone) (Nubecula geographus) 31 sodium channel inhibitor activity, toxin activity 75 G3, Geographutoxin I , Myotoxin I None 6491 extracellular region pathogenesis 2410412, 6852238 31 21:51 LPMDGDEPANRPVERMQDNISSEQYPLFEKR
PSQ00722 FD00092 Interleukin-1 alpha P01583 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 112 copper ion binding, cytokine activity, interleukin-1 receptor binding 271 Hematopoietin-1 IL1A 9606 cytosol, extracellular region, extracellular space apoptotic process, cellular response to heat, cellular response to lipopolysaccharide, cellular sodium ion homeostasis, connective tissue replacement involved in inflammatory response wound healing, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, immune response, inflammatory response, interleukin-1-mediated signaling pathway, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of vascular endothelial growth factor production, regulation of nitric-oxide synthase activity, response to copper ion 3281727 112 1:112 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPR
PSQ00723 FD00092 Interleukin-1 beta P01584 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 116 cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding 269 Catabolin IL1B 9606 cytosol, extracellular region, extracellular space, lysosome activation of MAPK activity, apoptotic process, cell-cell signaling, cellular response to drug, cellular response to lipopolysaccharide, cellular response to mechanical stimulus, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, embryo implantation, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, lipopolysaccharide-mediated signaling pathway, MAPK cascade, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of glucose transmembrane transport, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neurogenesis, negative regulation of synaptic transmission, positive regulation of angiogenesis, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell adhesion molecule production, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of complement activation, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of histone acetylation, positive regulation of histone phosphorylation, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuroinflammatory response, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein export from nucleus, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of T cell mediated immunity, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, positive regulation of vascular endothelial growth factor receptor signaling pathway, protein kinase B signaling, purinergic nucleotide receptor signaling pathway, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, signal transduction, smooth muscle adaptation, vascular endothelial growth factor production 3281727, 3920526 116 1:116 MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHD
PSQ00724 FD00127 Collagen alpha-1(I) chain P02452 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 139 extracellular matrix structural constituent, extracellular matrix structural constituent conferring tensile strength, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding 1464 Alpha-1 type I collagen COL1A1 9606 collagen type I trimer, collagen-containing extracellular matrix, cytoplasm, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, secretory granule blood coagulation, blood vessel development, bone trabecula formation, cartilage development involved in endochondral bone morphogenesis, cellular response to amino acid stimulus, cellular response to epidermal growth factor stimulus, cellular response to fibroblast growth factor stimulus, cellular response to fluoride, cellular response to mechanical stimulus, cellular response to retinoic acid, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, cellular response to vitamin E, collagen biosynthetic process, collagen fibril organization, collagen-activated tyrosine kinase receptor signaling pathway, embryonic skeletal system development, endochondral ossification, extracellular matrix organization, face morphogenesis, intramembranous ossification, leukocyte migration, negative regulation of cell-substrate adhesion, ossification, osteoblast differentiation, platelet activation, positive regulation of canonical Wnt signaling pathway, positive regulation of cell migration, positive regulation of epithelial to mesenchymal transition, positive regulation of transcription, DNA-templated, protein localization to nucleus, protein transport, regulation of immune response, response to cAMP, response to corticosteroid, response to drug, response to estradiol, response to hydrogen peroxide, response to hyperoxia, response to mechanical stimulus, response to peptide hormone, sensory perception of sound, skeletal system development, skin development, skin morphogenesis, tooth eruption, tooth mineralization, visual perception 5529814 139 23:161 QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP
PSQ00725 FD00127 Collagen alpha-1(I) chain P02453 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 139, 246 extracellular matrix structural constituent, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding 1463 Alpha-1 type I collagen COL1A1 9913 collagen type I trimer, cytoplasm, extracellular matrix, extracellular space blood vessel development, bone trabecula formation, cartilage development involved in endochondral bone morphogenesis, cellular response to amino acid stimulus, cellular response to mechanical stimulus, collagen biosynthetic process, collagen fibril organization, collagen-activated tyrosine kinase receptor signaling pathway, embryonic skeletal system development, endochondral ossification, extracellular matrix organization, face morphogenesis, intramembranous ossification, negative regulation of cell-substrate adhesion, ossification, osteoblast differentiation, positive regulation of canonical Wnt signaling pathway, positive regulation of cell migration, positive regulation of epithelial to mesenchymal transition, positive regulation of transcription, DNA-templated, protein localization to nucleus, protein transport, response to mechanical stimulus, sensory perception of sound, skeletal system development, skin development, skin morphogenesis, tooth mineralization, visual perception 4115172;11946479 385 23:161, 1218:1463 QEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQICVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP, DDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKEKRHVWYGESMTGGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPACFL
PSQ00726 FD00508 Collagen alpha-1(I) chain P02454 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 129 extracellular matrix structural constituent, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding 1453 Alpha-1 type I collagen Col1a1 10116 collagen trimer, collagen type I trimer, cytoplasm, endoplasmic reticulum, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, secretory granule blood vessel development, bone trabecula formation, cartilage development involved in endochondral bone morphogenesis, cellular response to amino acid stimulus, cellular response to epidermal growth factor stimulus, cellular response to fibroblast growth factor stimulus, cellular response to fluoride, cellular response to mechanical stimulus, cellular response to retinoic acid, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, cellular response to vitamin E, collagen biosynthetic process, collagen fibril organization, collagen-activated tyrosine kinase receptor signaling pathway, embryonic skeletal system development, endochondral ossification, extracellular matrix organization, face morphogenesis, intramembranous ossification, negative regulation of cell-substrate adhesion, ossification, osteoblast differentiation, positive regulation of canonical Wnt signaling pathway, positive regulation of cell migration, positive regulation of epithelial to mesenchymal transition, positive regulation of transcription, DNA-templated, protein localization to nucleus, protein transport, response to cAMP, response to corticosteroid, response to drug, response to estradiol, response to fluoride, response to hydrogen peroxide, response to hyperoxia, response to mechanical stimulus, response to nutrient, response to nutrient levels, response to peptide hormone, response to steroid hormone, sensory perception of sound, skeletal system development, skeletal system morphogenesis, skin development, skin morphogenesis, tooth eruption, tooth mineralization, visual perception, wound healing 5777344 129 23:151 QEDIPEVSCIHNGLRVPNGETWKPDVCLICICHNGTAVCDGVLCKEDLDCPNPQKREGECCPFCPEEYVSPDAEVIGVEGPKGDPGPQGPRGPVGPPGQDGIPGQPGLPGPPGPPGPPGPPGLGGNFAS
PSQ00727 FD00513 Collagen alpha-1(I) chain P02457 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 129, 246 extracellular matrix structural constituent, metal ion binding 1453 Alpha-1 type I collagen COL1A1 9031 collagen trimer, extracellular region None 4313735;6927845 375 23:151, 1208:1453 EGEEDIQTGSCVQDGLTYNDKDVWKPEPCQICVCDSGNILCDEVICEDTSDCPNAEIPFGECCPICPDVDASPVYPESAGVEGPKGDTGPRGDRGLPGPPGRDGIPGQPGLPGPPGPPGPPGLGGNFAP, DDANVMRDRDLEVDTTLKSLSQQIENIRSPEGTRKNPARTCRDLKMCHGDWKSGEYWIDPNQGCNLDAIKVYCNMETGETCVYPTQATIAQKNWYLSKNPKEKKHVWFGETMSDGFQFEYGGEGSNPADVAIQLTFLRLMSTEATQNVTYHCKNSVAYMDHDTGNLKKALLLQGANEIEIRAEGNSRFTYGVTEDGCTSHTGAWGKTVIEYKTTKTSRLPIIDLAPMDVGAPDQEFGIDIGPVCFL
PSQ00728 FD00509 Collagen alpha-2(I) chain P02465 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 57 extracellular matrix structural constituent, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding, protein-macromolecule adaptor activity, SMAD binding 1364 Alpha-2 type I collagen COL1A2 9913 collagen type I trimer, endoplasmic reticulum, extracellular matrix, extracellular space blood vessel development, bone mineralization, cellular response to amino acid stimulus, collagen fibril organization, collagen metabolic process, extracellular matrix assembly, extracellular matrix organization, protein heterotrimerization, regulation of blood pressure, Rho protein signal transduction, skeletal system development, skin morphogenesis, transforming growth factor beta receptor signaling pathway 4609475 57 23:79 QSLQEATARKGPSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFAA
PSQ00729 FD00210 Aequorin-2 P02592 Eukaryota Metazoa Cnidaria Hydrozoa Hydroidolina Leptothecata Aequoreidae Aequorea Aequorea victoria (Jellyfish) 7 calcium ion binding 196 None None 6100 None bioluminescence 2866797 7 1:7 MTSKQYS
PSQ00730 FD00427 Alpha-2-HS-glycoprotein P02765 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 40 cysteine-type endopeptidase inhibitor activity, endopeptidase inhibitor activity, kinase inhibitor activity 367 Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A AHSG 9606 blood microparticle, collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, platelet alpha granule lumen, secretory granule lumen acute-phase response, cellular protein metabolic process, negative regulation of bone mineralization, negative regulation of endopeptidase activity, negative regulation of insulin receptor signaling pathway, neutrophil degranulation, pinocytosis, platelet degranulation, positive regulation of phagocytosis, post-translational protein modification, regulation of bone mineralization, regulation of inflammatory response, skeletal system development 6833285 40 301:340 LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTR
PSQ00731 FD00540 Albumin P02770 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 6 chaperone binding, DNA binding, enterobactin binding, enzyme binding, exogenous protein binding, fatty acid binding, identical protein binding, modified amino acid binding, pyridoxal phosphate binding, toxic substance binding, zinc ion binding 608 None Alb 10116 basement membrane, cytoplasm, extracellular exosome, extracellular region, extracellular space, protein-containing complex cellular response to starvation, maintenance of mitochondrion location, negative regulation of apoptotic process, positive regulation of circadian sleep/wake cycle, non-REM sleep, response to mercury ion, response to nutrient, response to organic substance, response to platinum ion, vasodilation 893447 6 19:24 RGVFRR
PSQ00732 FD00042 Osteocalcin P02818 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 28 calcium ion binding, hydroxyapatite binding, structural constituent of bone, structural molecule activity 100 Bone Gla protein, Gamma-carboxyglutamic acid-containing protein BGLAP 9606 cytoplasm, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, perikaryon, rough endoplasmic reticulum, vesicle bone development, bone mineralization, cell adhesion, cell aging, cellular response to growth factor stimulus, cellular response to vitamin D, endoplasmic reticulum to Golgi vesicle-mediated transport, odontogenesis, osteoblast development, osteoblast differentiation, regulation of bone mineralization, regulation of bone resorption, regulation of cellular response to insulin stimulus, regulation of osteoclast differentiation, response to activity, response to drug, response to estrogen, response to ethanol, response to glucocorticoid, response to gravity, response to hydroxyisoflavone, response to mechanical stimulus, response to testosterone, response to vitamin D, response to vitamin K, response to zinc ion, skeletal system development 6967872 28 24:51 KPSGAESSKGAAFVSKQEGSEVVKRPRR
PSQ00733 FD00042 Osteocalcin P02820 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 28 calcium ion binding, hydroxyapatite binding, structural constituent of bone 100 Bone Gla protein, Gamma-carboxyglutamic acid-containing protein BGLAP 9913 cytoplasm, extracellular region biomineral tissue development, bone development, osteoblast differentiation, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin K 1068450 28 24:51 KPGDAESGKGAAFVSKQEGSEVVKRLRR
PSQ00734 FD00042 Osteocalcin P02822 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 28 calcium ion binding, hydroxyapatite binding, structural constituent of bone 97 Bone Gla protein, Gamma-carboxyglutamic acid-containing protein BGLAP 9031 extracellular region biomineral tissue development, bone development, osteoblast differentiation, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin K 6792200 28 21:48 APDGSDARSAKAFISHRQRAEMVRRQKR
PSQ00735 FD00261 Secapin P02852 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis Apis mellifera (Honeybee) 20 None 77 None None 7460 extracellular region None 631126 20 33:52 VSNDMQPLEARSADLVPEPR
PSQ00736 FD00045 Concanavalin-A P02866 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Canavalia Canavalia ensiformis (Jack bean) (Dolichos ensiformis) 15 mannose binding, metal ion binding 290 None None 3823 None None 1112813 15 149:163 VIRNSTTIDFNAAYN
PSQ00737 FD00045 Lectin P02870 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lens Lens culinaris (Lentil) (Cicer lens) 7 calcium ion binding, carbohydrate binding, manganese ion binding, mannose binding 275 None None 3864 None carbohydrate mediated signaling 274705 7 211:217 NSLEEEN
PSQ00738 FD00479 Pro-hevein P02877 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Euphorbiaceae Crotonoideae Micrandreae Hevea Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis) 6 chitin binding, ribonuclease activity 204 Major hevein HEV1 3981 None defense response to bacterium, defense response to fungus 1874741 6 61:66 SGEGVG
PSQ00739 FD00368 Thaumatin I P02883 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Zingiberales Marantaceae Thaumatococcus Thaumatococcus daniellii (Katemfe) (Phrynium daniellii) 6 None 240 Thaumatin-1 None 4621 cytoplasmic vesicle None 456365 6 230:235 LELEDE
PSQ00740 FD00199 Bacteriorhodopsin P02945 Archaea Euryarchaeota Stenosarchaea group Halobacteria Halobacteriales Halobacteriaceae Halobacterium Halobacterium salinarum (strain ATCC 700922 , (Halobacterium halobium) 13 ion channel activity, photoreceptor activity 262 Bacterioopsin bop 64091 integral component of membrane, plasma membrane phototransduction, protein-chromophore linkage 291920, 9541408 13 1:13 MLELLPTAVEGVS
PSQ00741 FD00102 Fimbrial protein P02973 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa 6 None 150 Pilin pilA 287 integral component of membrane, pilus cell adhesion 6131838 6 1:6 MKAQKG
PSQ00742 FD00240 Type IV major pilin protein PilE1 P02974 Bacteria Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria gonorrhoeae 7 None 165 MS11 antigen, Pilin pilE1 485 integral component of membrane, pilus cell adhesion 413571, 6143785 7 1:7 MNTLQKG
PSQ00743 FD00102 Type IV major fimbrial protein FimA P02975 Bacteria Proteobacteria Gammaproteobacteria Cardiobacteriales Cardiobacteriaceae Dichelobacter Dichelobacter nodosus (Bacteroides nodosus) 7 None 158 198 antigen, Pilin, Serogroup A1 fimA 870 integral component of membrane, pilus cell adhesion 6653780 7 1:7 MKSLQKG
PSQ00744 FD00241 Immunoglobulin G-binding protein A P02976 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus (strain NCTC 8325 31 IgG binding 516 Staphylococcal protein A spa 93061 cell wall, extracellular region pathogenesis 10427003, 7830549 31 486:516 GEENPFIGTTVFGGLSLALGAALLAGRRREL
PSQ00745 FD00551 Pre-hexon-linking protein IIIa P03279 Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) 15 None 585 Capsid vertex-specific component IIIa , Protein IIIa , pIIIa None 10515 host cell nucleus, viral capsid, decoration None 2691633 15 571:585 GNPFAHLRPRLGRMF
PSQ00746 FD00229 Core protein VP8 P03295 Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain, WR)) 32 structural molecule activity 251 25 kDa major core protein, F5 polypeptide, L4 core protein, P25K None 10254 viral capsid None 1993877, 3201753 32 1:32 MSLLLENLIEEDTIFFAGSISEYDDLQMVIAG
PSQ00747 FD00421 Capsid protein P03607 Viruses Riboviria Orthornavirae Pisuviricota Pisoniviricetes Sobelivirales Solemoviridae Sobemovirus Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain, cowpea)) 19 calcium ion binding, lipid binding, RNA binding, structural constituent of virion 279 Coat protein None 196398 T None 18635141 19 1:19 MSGLFHHRTKPREIRAFVM
PSQ00748 FD00071 Pepsin A-1 P03954 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Macaca Macaca fuscata fuscata (Japanese macaque) 25 aspartic-type endopeptidase activity 388 Pepsin III-3 PGA 9543 extracellular region digestion 3514596 25 16:40 IIYKVPLVRKKSLRRNLSEHGLLKD
PSQ00749 FD00039 Interstitial collagenase P03956 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 80 endopeptidase activity, metalloendopeptidase activity, peptidase activity, serine-type endopeptidase activity, zinc ion binding 469 Fibroblast collagenase, Matrix metalloproteinase-1 MMP1 9606 extracellular matrix, extracellular region cellular protein metabolic process, cellular response to UV-A, collagen catabolic process, cytokine-mediated signaling pathway, extracellular matrix disassembly, extracellular matrix organization, leukocyte migration, positive regulation of protein-containing complex assembly, proteolysis, viral process 2557822 80 20:99 FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQ
PSQ00750 FD00039 Stromelysin-1 P03957 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 80 endopeptidase activity, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, protein-containing complex binding, zinc ion binding 480 Matrix metalloproteinase-3, PTR1 protein, Transin-1 Mmp3 10116 cell body, cytosol, dendrite, extracellular matrix, extracellular space, mitochondrion, nucleus, protein-containing complex cellular response to amino acid stimulus, cellular response to cell-matrix adhesion, cellular response to interleukin-1, cellular response to UV-A, collagen catabolic process, extracellular matrix organization, female pregnancy, negative regulation of hydrogen peroxide metabolic process, negative regulation of protein kinase B signaling, positive regulation of cell migration, positive regulation of oxidative stress-induced cell death, positive regulation of protein-containing complex assembly, protein catabolic process, proteolysis, regulation of cell migration, response to amino acid, response to cytokine, response to estradiol, response to hypoxia, response to interleukin-1, response to lipopolysaccharide, response to mechanical stimulus, response to tumor necrosis factor, wound healing 2841336 80 18:97 YPLHGSEEDAGMEVLQKYLENYYGLEKDVKQFTKKKDSSPVVKKIQEMQKFLGLKMTGKLDSNTMELMHKPRCGVPDVGG
Total Pages 43
Go to Lab Web Page