Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00601 FD00290 Extracellular superoxide dismutase O09164 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 9 copper ion binding, superoxide dismutase activity 251 None Sod3 10090 collagen-containing extracellular matrix, cytoplasm, extracellular space, Golgi lumen, nucleus blood vessel diameter maintenance, removal of superoxide radicals, response to copper ion, response to hypoxia 9376114 9 16:24 SVTMSNPGE
PSQ00602 FD00167 Prosaposin O13035 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 50 None 518 Proactivator polypeptide PSAP 9031 extracellular space, lysosome adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway, regulation of lipid metabolic process, sphingolipid metabolic process 9461526 50 144:193 KHLAAMKLQKQLQSNKIPELDFSELTSPFMANVPLLLYPQDKPKQKSKAT
PSQ00603 FD00087 Tripeptidyl-peptidase 1 O14773 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 176 endopeptidase activity, lysophosphatidic acid binding, metal ion binding, peptidase activity, peptide binding, serine-type endopeptidase activity, serine-type peptidase activity, sulfatide binding, tripeptidyl-peptidase activity 563 Cell growth-inhibiting gene 1 protein, Lysosomal pepstatin-insensitive protease, Tripeptidyl aminopeptidase, Tripeptidyl-peptidase I TPP1 9606 extracellular exosome, Golgi apparatus, lysosomal lumen, lysosome, melanosome, membrane raft, recycling endosome bone resorption, central nervous system development, epithelial cell differentiation, IRE1-mediated unfolded protein response, lipid metabolic process, lysosomal protein catabolic process, lysosome organization, nervous system development, neuromuscular process controlling balance, peptide catabolic process, protein catabolic process, protein localization to chromosome, telomeric region, proteolysis 11054422, 25944712 176 20:195 SYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVG
PSQ00604 FD00031 Defensin-2 O16137 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Muscoidea Muscidae Stomoxys Stomoxys calcitrans (Stable fly) (Conops calcitrans) 34 None 97 None SMD2 35570 extracellular region defense response to bacterium, innate immune response 9326639 34 24:57 APSAGNEVDHHPDYVDGVEALRQLEPELHGRYKR
PSQ00605 FND00350 Kappa-stichotoxin-Hmg1a O16846 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Stichodactylidae Heteractis Heteractis magnifica (Magnificent sea anemone) (Radianthus magnifica) 17 toxin activity 74 Potassium channel toxin HmK None 38281 extracellular region, nematocyst None 9298966 17 23:39 RMELQDVEDMENGFQKR
PSQ00606 FND00053 Ceratotoxin-A O17512 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Tephritoidea Tephritidae Ceratitis Ceratitis Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata) 12 None 71 None CTXA2 7213 extracellular region defense response to bacterium, hemolysis in other organism, innate immune response 8353519 12 24:35 EPAAEDSIVVKR
PSQ00607 FD00090 Clavanin-C O18493 Eukaryota Metazoa Chordata Tunicata Ascidiacea Stolidobranchia Styelidae Styela Styela clava (Sea squirt) 10 None 80 None None 7725 extracellular region defense response to bacterium 9001389 10 20:29 LEERKSEEEK
PSQ00608 FD00107 Vacuolar-processing enzyme O24325 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Phaseolus Phaseolus vulgaris (Kidney bean) (French bean) 20 cysteine-type endopeptidase activity 484 Legumain-like proteinase None 3885 None proteolysis involved in cellular protein catabolic process 9874222 20 25:44 GRDLVGDFLRLPSDSGNGDN
PSQ00609 FD00376 Sporulation killing factor O31422 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 29 None 60 Sporulation-killing factor SkfA skfA 224308 extracellular region cytolysis, defense response to bacterium 20805502 29 1:29 MKRNQKEWESVSKKGLMKPGGTSIVKAAG
PSQ00610 FD00289 Sporulation delaying protein C O34344 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 108, 21 toxin activity 203 Cannibalism toxin SDP , Killing factor SdpC, Toxic peptide SdpC sdpC 224308 extracellular region cell killing, cytolysis, defense response to bacterium, pathogenesis 20805502;20805502 129 33:140, 183:203 KENHTFSGEDYFRGLLFGQGEVGKLISNDLDPKLVKEANSTEGKKLVNDVVKFIKKDQPQYMDELKQSIDSKDPKKLIENMTKADQLIQKYAKKNENVKYSSNKVTPS, SASNNSDLEAAAAKTLKLIHQ
PSQ00611 FD00251 Pro-neuregulin-2 O35569 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 127 epidermal growth factor receptor binding, epidermal growth factor-activated receptor activity, ErbB-3 class receptor binding, growth factor activity, signaling receptor binding 868 None Nrg2 10116 extracellular space, GABA-ergic synapse, glutamatergic synapse, integral component of membrane, plasma membrane animal organ development, epidermal growth factor receptor signaling pathway, intracellular signal transduction, nervous system development, regulation of synapse assembly, regulation of synapse maturation 9348101 127 1:127 MRQVCCSALPPPLEKARCSSYSYSDSSSSSSSNNSSSSTSSRSSSRSSSRSSRGSTTTTSSSENSGSNSGSIFRPAAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGSSMLLFGVSLA
PSQ00612 FD00004 Thrombin-like enzyme CPI-enzyme 2 O42207 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Gloydius Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis) 6 serine-type endopeptidase activity, toxin activity 258 Capillary permeability-increasing enzyme 2 None 35671 extracellular region None 8303716 6 19:24 QKSSEL
PSQ00613 FD00106 Endopolygalacturonase E O42809 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati Aspergillus niger 20 polygalacturonase activity 378 Pectinase 4, Pectinase E, Polygalacturonase E, Polygalacturonase IV pgaE 5061 extracellular region carbohydrate metabolic process, cell wall organization 9492270 20 20:39 SPVADPLVTPAPKLEDLEKR
PSQ00614 FD00189 Serine protease HTRA2 O43464 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 102 identical protein binding, peptidase activity, serine-type endopeptidase activity, serine-type peptidase activity, unfolded protein binding 458 High temperature requirement protein A2, Omi stress-regulated endoprotease, Serine protease 25, Serine proteinase OMI HTRA2 9606 CD40 receptor complex, chromatin, cytoplasmic side of plasma membrane, cytoskeleton, cytosol, endoplasmic reticulum, endoplasmic reticulum membrane, membrane, mitochondrial intermembrane space, mitochondrial membrane, mitochondrion, nucleus, serine-type endopeptidase complex adult walking behavior, aging, cellular protein catabolic process, cellular response to growth factor stimulus, cellular response to heat, cellular response to interferon-beta, cellular response to oxidative stress, cellular response to retinoic acid, ceramide metabolic process, execution phase of apoptosis, forebrain development, intrinsic apoptotic signaling pathway in response to DNA damage, mitochondrion organization, negative regulation of cell cycle, negative regulation of mitophagy in response to mitochondrial depolarization, negative regulation of neuron death, negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway, neuron development, pentacyclic triterpenoid metabolic process, positive regulation of apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of mitochondrion organization, positive regulation of protein targeting to mitochondrion, programmed cell death, protein autoprocessing, proteolysis, regulation of autophagy of mitochondrion, regulation of multicellular organism growth, response to herbicide 11583623 102 32:133 TPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLA
PSQ00615 FD00244 Peptidase inhibitor 15 O43692 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 41 peptidase inhibitor activity 258 25 kDa trypsin inhibitor, Cysteine-rich secretory protein 8, SugarCrisp PI15 9606 extracellular exosome, extracellular space multicellular organism development 8882727 41 20:60 STVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR
PSQ00616 FD00129 Vascular endothelial growth factor D O43915 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 67 chemoattractant activity, growth factor activity, identical protein binding, platelet-derived growth factor receptor binding, vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor binding 360 c-Fos-induced growth factor VEGFD 9606 extracellular region, extracellular space, membrane, platelet alpha granule lumen cell population proliferation, dopaminergic neuron differentiation, induction of positive chemotaxis, platelet degranulation, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of endothelial cell proliferation, positive regulation of mast cell chemotaxis, positive regulation of protein phosphorylation, response to bacterium, response to hypoxia, sprouting angiogenesis, vascular endothelial growth factor receptor signaling pathway, vascular endothelial growth factor signaling pathway 10542248 67 22:88 SSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFTSMDSRSASHRSTR
PSQ00617 FND00316 Potassium channel toxin alpha-KTx 10 O46028 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Centruroides Centruroides noxius (Mexican scorpion) 6 toxin activity 62 Cobatoxin-1 , gtIX None 6878 extracellular region None 9688256 6 23:28 NWNTEA
PSQ00618 FD00464 L-galactono-1,4-lactone dehydrogenase, mitochondrial O47881 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Brassiceae Brassica Brassica oleracea (Wild cabbage) 66 D-arabinono-1,4-lactone oxidase activity, FAD binding, galactonolactone dehydrogenase activity, L-gulono-1,4-lactone dehydrogenase activity 600 None None 3712 integral component of membrane, mitochondrial membrane, plastid L-ascorbic acid biosynthetic process 9374475 66 26:91 CTSGQTLTPAPPPPPPPPPPISSSASEKEFRKYAGYAALALFSGAATYFSFPFPENAKHKKAQIFR
PSQ00619 FD00036 Lantibiotic mutacin-2 O54329 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus mutans 26 signaling receptor binding 60 Lantibiotic mutacin H-29B, Mutacin II mutA 1309 extracellular region amino acid transport, cytolysis, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, regulation of membrane potential 10821848, 16626493, 8021218, 9647795 26 1:26 MNKLNSNAVVSLNEVSDSELDTILGG
PSQ00620 FD00186 Zona pellucida sperm-binding protein 1 O54766 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 73 structural constituent of egg coat 617 Zona pellucida glycoprotein 1 Zp1 10116 collagen-containing extracellular matrix, egg coat, extracellular region, integral component of membrane, plasma membrane single fertilization 16342937 73 545:617 RRSSGHHNSTIRALDIVSSPGAVGFEDAPKLEPSGSTRNSGSRPLLWVLQLLALTLVLGDGVLVGLSWAWAWA
PSQ00621 FD00124 Sortilin O54861 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 42 enzyme binding, G protein-coupled neurotensin receptor activity, nerve growth factor binding, nerve growth factor receptor activity, neurotensin receptor activity, non-G protein-coupled, retromer complex binding 825 Glycoprotein 110, Neurotensin receptor 3 Sort1 10116 cell surface, clathrin-coated pit, clathrin-coated vesicle, cytoplasmic vesicle, cytoplasmic vesicle membrane, cytosol, dendrite, early endosome, endoplasmic reticulum membrane, endosome membrane, Golgi apparatus, Golgi cisterna membrane, integral component of membrane, intracellular membrane-bounded organelle, lysosomal membrane, lysosome, neuronal cell body, nuclear membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network transport vesicle endocytosis, endosome to lysosome transport, endosome transport via multivesicular body sorting pathway, extrinsic apoptotic signaling pathway via death domain receptors, G protein-coupled receptor signaling pathway, glucose import, Golgi to endosome transport, Golgi to lysosome transport, intracellular protein transport, multicellular organism development, myotube differentiation, negative regulation of fat cell differentiation, negative regulation of lipoprotein lipase activity, neuropeptide signaling pathway, neurotrophin TRK receptor signaling pathway, ossification, plasma membrane to endosome transport, positive regulation of epithelial cell apoptotic process, post-Golgi vesicle-mediated transport, protein targeting to lysosome, regulation of gene expression, response to insulin, vesicle organization 26479776 42 32:73 QDRLDAPPPPAPPLLRWAGPVGVSWGLRAAAPGGPVPRAGRW
PSQ00622 FD00077 Acetylxylan esterase 2 O59893 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Trichocomaceae Talaromyces Talaromyces sect Talaromyces Talaromyces purpureogenus (Soft rot fungus) (Penicillium purpureogenum) 10 acetylxylan esterase activity 240 AXE II axe-2 1266744 extracellular region cellulose catabolic process, xylan catabolic process 8756392, 9506837 10 18:27 IPLEGVMEKR
PSQ00623 FD00085 Aspartic protease O60020 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Tremellomycetes Cystofilobasidiales Mrakiaceae Phaffia Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous) 60 aspartic-type endopeptidase activity 405 None pr1 264483 extracellular region proteolysis 10091328 60 22:81 APVDATATSTSGIIAVPISKSAAQLAREADPVVSLDWLKKTKAQAQYKHKQANARLHSKR
PSQ00624 FD00396 Cubilin O60494 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 12 calcium ion binding, cargo receptor activity, cobalamin binding, protein homodimerization activity, signaling receptor activity 3623 460 kDa receptor, Intestinal intrinsic factor receptor, Intrinsic factor-cobalamin receptor, Intrinsic factor-vitamin B12 receptor CUBN 9606 apical plasma membrane, brush border membrane, clathrin-coated pit, cytosol, endocytic vesicle, endoplasmic reticulum, endosome membrane, extracellular exosome, extrinsic component of external side of plasma membrane, Golgi apparatus, lysosomal lumen, lysosomal membrane, membrane, plasma membrane, receptor complex cholesterol metabolic process, cobalamin metabolic process, cobalamin transport, high-density lipoprotein particle clearance, lipoprotein transport, receptor-mediated endocytosis, response to bacterium, tissue homeostasis, vitamin D metabolic process 9572993 12 24:35 EAGELELQRQKR
PSQ00625 FND00160 Kinetoplast-associated protein 1 O61016 Eukaryota Discoba Euglenozoa Kinetoplastea Metakinetoplastina Trypanosomatida Trypanosomatidae Leishmaniinae Crithidia Crithidia fasciculata 9 DNA binding 151 Histone H1-like protein p21 KAP4 5656 kinetoplast None 8446592 9 1:9 MLRVSVRSL
PSQ00626 FD00371 Subtilisin-like protease 1 O61142 Eukaryota Sar Alveolata Apicomplexa Aconoidasida Haemosporida Plasmodiidae Plasmodium Plasmodium (Laverania) Plasmodium falciparum 194 metal ion binding, serine-type endopeptidase activity 690 PfSUB-1 SUB1 5833 extracellular region None 12764150, 10617661 194 26:219 KEVRSEENGKIQDDAKKIVSELRFLEKVEDVIEKSNIGGNEVDADENSFNPDTEVPIEEIEEIKMRELKDVKEEKNKNDNHNNNNNNNNISSSSSSSSNTFGEEKEEVSKKKKKLRLIVSENHATTPSFFQESLLEPDVLSFLESKGNLSNLKNINSMIIELKEDTTDDELISYIKILEEKGALIESDKLVSAD
PSQ00627 FD00159 Plasmatocyte-spreading peptide O61704 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Plusiinae Chrysodeixis Chrysodeixis includens (Soybean looper) (Pseudoplusia includens) 96 cytokine activity 141 None PSP1 689277 extracellular space None 9287360 96 23:118 NLRDLFNNVRGSISSSANKIRQDVKTLFHPSDKSGNKESSNIVFVEDKDEGAVGPARDNKPVAVTPAPVVSTTTQASAPTVATNGTATGGKDDKGR
PSQ00628 FD00056 Subtilisin-like protease SBT1 O65351 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 82 serine-type endopeptidase activity 757 Cucumisin-like serine protease, Subtilase subfamily 1 member 7 , Subtilisin-like serine protease 1 SBT1 3702 apoplast, cell wall, extracellular region, secretory vesicle mucilage extrusion from seed coat, mucilage metabolic process involved in seed coat development, seed coat development 12413398, 9188482 82 25:106 SSSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELH
PSQ00629 FD00567 Lantibiotic mutacin-1140 O68586 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus mutans 41 signaling receptor binding 63 Mutacin III lanA 1309 extracellular region cytolysis, defense response to bacterium 11082191 41 1:41 MSNTQLLEVLGTETFDVQEDLFAFDTTDTTIVASNDDPDTR
PSQ00630 FD00228 Trehalose phosphorylase O75003 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Polyporales Grifolaceae Grifola Grifola frondosa (Maitake) (Polyporus frondosus) 25 alpha,alpha-trehalose phosphorylase (configuration-retaining) activity 732 Trehalose synthase None 5627 None glucose 6-phosphate metabolic process, glucose metabolic process, trehalose metabolic process 9763690 25 1:25 MAPPHQFQSKPSDVIRRRLSSAVSS
PSQ00631 FD00531 Attractin O75882 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 55 carbohydrate binding, signaling receptor activity 1429 DPPT-L, Mahogany homolog ATRN 9606 basement membrane, cytoplasm, extracellular exosome, extracellular space, integral component of plasma membrane, plasma membrane animal organ morphogenesis, cell migration, cerebellum development, inflammatory response, myelination, pigmentation, regulation of multicellular organism growth, response to oxidative stress, substrate adhesion-dependent cell spreading, tissue development 17261078 55 29:83 PHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPRLLLLLLLLSPPLLLLLLPCEAEA
PSQ00632 FD00146 Delta-ctenitoxin-Pn2c O76199 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 17 toxin activity 82 Neurotoxin Pn2-5A , Neurotoxin Tx2-5 None 6918 extracellular region None 1397265, 16278100, 1801316, 19231838 17 18:34 ESIEESRDDFAVEELGR
PSQ00633 FD00178 Kappa-ctenitoxin-Pn1a O76200 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 16, 6 ion channel inhibitor activity, toxin activity 83 Neurotoxin Tx3-1 , PNTx3-1, PhKv None 6918 extracellular region pathogenesis 8446961;8446961 22 22:37, 78:83 EPNSSPNNPLIVEEDR, LFGFGK
PSQ00634 FD00178 Omega-ctenitoxin-Pn1a O76201 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 16 ion channel inhibitor activity, toxin activity 82 Neurotoxin Tx3-2, PNTx3-2 None 6918 extracellular region pathogenesis 8446961 16 22:37 EPNSSPNNPLIEEEAR
PSQ00635 FD00085 Cathepsin D O76856 Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) 30 aspartic-type endopeptidase activity 383 Ddp44 ctsD 44689 early endosome, early phagosome, extracellular region, lysosome, phagocytic vesicle programmed cell death 10523518 30 19:48 LTVPLNFHQASRESRRRVPQKWSNRLSALN
PSQ00636 FND00152 Bomanin Short 2 O77150 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 7 None 45 Bomanin-2 , Immune-induced peptide 2 BomS2 7227 extracellular region defense response, innate immune response, response to bacterium 12171930 7 21:27 VPLSPDP
PSQ00637 FND00223 Precursor of CEP3 O80460 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 39 hormone activity 82 None CEP3 3702 apoplast, extracellular region cellular response to nitrogen starvation, nitrate import, regulation of lateral root development, regulation of leaf morphogenesis, regulation of root development, regulation of shoot system development, response to auxin, response to carbon dioxide, response to light intensity, response to nitrate starvation, response to nitrogen compound, response to osmotic stress, response to potassium ion, response to salt stress, response to sucrose, response to temperature stimulus, root development 25324386 39 25:63 RKLTKFTVTTSEEIRAGGSVLSSSPPTEPLESPPSHGVD
PSQ00638 FD00086 Arabinogalactan protein 16 O82337 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 36 None 73 Arabinogalactan peptide 16 AGP16 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 36 38:73 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF
PSQ00639 FD00056 Subtilisin-like protease SBT3 O82777 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 90 identical protein binding, protein homodimerization activity, serine-type endopeptidase activity, serine-type peptidase activity 761 LeSBT3 , SlSBT3 , Subtilase 3 sbt3 4081 extracellular space defense response, peptide catabolic process, plant-type cell wall modification, positive regulation of defense response to insect, positive regulation of gene expression, proteolysis, regulation of cell wall pectin metabolic process, response to wounding, self proteolysis 19332543 90 23:112 QRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSVDRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPH
PSQ00640 FD00144 Serine-aspartate repeat-containing protein D O86488 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus (strain Newman) 34 None 1320 None sdrD 426430 cell wall, extracellular region cell adhesion 11830639 34 1282:1315 GNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK
PSQ00641 FD00256 Serine-aspartate repeat-containing protein E O86489 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus (strain Newman) 34 None 1166 None sdrE 426430 cell wall, extracellular region cell adhesion, pathogenesis 11830639 34 1133:1166 GSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK
PSQ00642 FD00038 Lantibiotic lacticin 3147 A1 O87236 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 29 signaling receptor binding 60 None ltnA1 1360 extracellular region cytolysis, defense response to Gram-positive bacterium 10608807, 15023056 29 1:29 MNKNEIETQPVTWLEEVSDQNFDEDVFGA
PSQ00643 FND00296 Lantibiotic lacticin 3147 A2 O87237 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 36 signaling receptor binding 65 None ltnA2 1360 extracellular region cytolysis, defense response to Gram-positive bacterium 15023056 36 1:36 MKEKNMKKNDTIELQLGKYLEDDMIELAEGDESHGG
PSQ00644 FD00278 Lanthionine-containing peptide SapB precursor RamS O88038 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces albidoflavus group Streptomyces coelicolor (strain ATCC BAA-471 21 None 42 ProSapB ramS 100226 extracellular region, plasma membrane, spore wall None 15277670, 2032288 21 1:21 MNLFDLQSMETPKEEAMGDVE
PSQ00645 FD00208 Caspase-8 O89110 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 218, 11 cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, death effector domain binding, death receptor binding, endopeptidase activity, identical protein binding, peptidase activity, protein-containing complex binding, scaffold protein binding, tumor necrosis factor receptor binding, ubiquitin protein ligase binding 480 None Casp8 10090 CD95 death-inducing signaling complex, cell body, cytoplasm, cytosol, death-inducing signaling complex, membrane raft, mitochondrion, neuron projection, Noc1p-Noc2p complex, nucleoplasm, nucleus, plasma membrane, protein-containing complex, ripoptosome activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, angiogenesis, apoptotic process, apoptotic signaling pathway, cardiac muscle tissue development, execution phase of apoptosis, extrinsic apoptotic signaling pathway, extrinsic apoptotic signaling pathway via death domain receptors, heart development, hepatocyte apoptotic process, macrophage differentiation, negative regulation of I-kappaB kinase/NF-kappaB signaling, negative regulation of necroptotic process, neural tube formation, positive regulation of apoptotic process, positive regulation of extrinsic apoptotic signaling pathway, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of interleukin-1 beta production, positive regulation of macrophage differentiation, positive regulation of neuron death, positive regulation of proteolysis, protein processing, proteolysis, proteolysis involved in cellular protein catabolic process, pyroptosis, regulation of apoptotic signaling pathway, regulation of cytokine production, regulation of innate immune response, regulation of thymocyte apoptotic process, response to ethanol, response to tumor necrosis factor, self proteolysis, TRAIL-activated apoptotic signaling pathway 31511692;31511692 229 1:218, 377:387 MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQD, FEQQNHTLEVD
PSQ00646 FD00193 Cathepsin D O93428 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Perciformes Notothenioidei Channichthyidae Chionodraco Chionodraco hamatus (Antarctic teleost icefish) (Chaenichthys rhinoceratus, hamatus) 43 aspartic-type endopeptidase activity 396 None ctsd 36188 lysosome proteolysis 10209280 43 19:61 LVRIPLKKFRSIRRQLTDSGKRAEELLADHHSLKYNLSFPASN
PSQ00647 FND00016 Plasticin-DA1 O93454 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) 20 None 71 Dermaseptin PD-3-6 None 75988 extracellular region, membrane, other organism cell membrane defense response, hemolysis in other organism 15222751 20 23:42 EAEKREEENEEKQEDDDESE
PSQ00648 FD00061 Cholecystokinin O93464 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Ostariophysi Cypriniformes Cyprinidae Cyprininae Carassius Carassius auratus (Goldfish) 84, 9 hormone activity 123 CCK8 cck 7957 extracellular region feeding behavior, growth hormone secretion, peptide hormone secretion 9493851;9493851 93 20:103, 115:123 LSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDR, SAEEYEYSS
PSQ00649 FD00327 Phosphatidylglycerol O94183 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati Aspergillus oryzae (strain ATCC 42149 16 None 180 None pltp 510516 cytoplasmic vesicle, Golgi apparatus intracellular sterol transport 7742351 16 22:37 RSLDFFKSSQSPIQAQ
PSQ00650 FD00027 Versatile peroxidase VPL2 O94753 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Pleurotaceae Pleurotus Pleurotus eryngii (Boletus of the steppes) 8 23:30 361 Versatile liquid phase peroxidase 2 vpl2 5323 extracellular region hydrogen peroxide catabolic process, lignin catabolic process, response to oxidative stress 9987124 8 23:30 AVPLVQKR
Total Pages 43
Go to Lab Web Page