Details of PSQ01040
| ProSeqID |
PSQ01040 |
| Family |
FD00275 |
| Protein Name |
Pilin |
| UniProt ID |
P12060
|
| Taxonomy |
Bacteria-Proteobacteria-Gammaproteobacteria-Enterobacterales-Enterobacteriaceae-Salmonella |
| Organisms |
Salmonella typhi |
| Prosequence Length (aa) |
55 |
| Functions |
None |
| Preproprotein Length (aa) |
120 |
| Alt Name |
None |
| Gene Name |
traA |
| NCBI ID |
90370 |
| Cellular Localization |
extracellular region, integral component of membrane, plasma membrane |
| Processes |
conjugation |
| PubMed |
6130062
|
| Total Prosequence Length (aa) |
55 |
| Prosequence Location |
1:55 |
| Prosequence Sequence |
MNLSFAKGGLPAPVKNRAWQYCQMAWRGVTSKKALSRLAALSPLLLLGVGQMASA |
| Preproprotein Sequence |
MNLSFAKGGLPAPVKNRAWQYCQMAWRGVTSKKALSRLAALSPLLLLGVGQMASATDLLAGGKDDVKATFGADSFVMMCIIIAELIVGVAMYIRTKNLLILLGLVVVIVFTTVGLTFIK |