Details of PSQ02108
| ProSeqID |
PSQ02108 |
| Family |
FD00115 |
| Protein Name |
Neutrophil antibiotic peptide NP-3B |
| UniProt ID |
Q9Z1F1
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
39 |
| Functions |
None |
| Preproprotein Length (aa) |
87 |
| Alt Name |
Neutrophil defensin 3 |
| Gene Name |
None |
| NCBI ID |
10116 |
| Cellular Localization |
extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism |
| PubMed |
2543629
|
| Total Prosequence Length (aa) |
39 |
| Prosequence Location |
20:58 |
| Prosequence Sequence |
ESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVT |
| Preproprotein Sequence |
MRTLILLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCSCRTSSCRFGERLSGACRLNGRIYRLCC |