Details of PSQ02006
| ProSeqID |
PSQ02006 |
| Family |
FD00003 |
| Protein Name |
Conotoxin elongated-tx3a-a |
| UniProt ID |
Q9BH73
|
| Taxonomy |
Eukaryota-Metazoa-Spiralia-Lophotrochozoa-Mollusca-Gastropoda-Caenogastropoda-Neogastropoda-Conoidea-Conidae-Conus-Cylinder |
| Organisms |
Conus textile (Cloth-of-gold cone) |
| Prosequence Length (aa) |
20 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
70 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
6494 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
22709442
|
| Total Prosequence Length (aa) |
20 |
| Prosequence Location |
25:44 |
| Prosequence Sequence |
DQPVERYAENKQLLSPDERR |
| Preproprotein Sequence |
MLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLSPDERREIILHALGTRCCSWDVCDHPSCTCCG |