Details of PSQ01943
| ProSeqID |
PSQ01943 |
| Family |
FND00287 |
| Protein Name |
Arabinogalactan protein 40 |
| UniProt ID |
Q8LD43
|
| Taxonomy |
Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Malvids-Brassicales-Brassicaceae-Camelineae-Arabidopsis |
| Organisms |
Arabidopsis thaliana (Mouse-ear cress) |
| Prosequence Length (aa) |
27 |
| Functions |
None |
| Preproprotein Length (aa) |
62 |
| Alt Name |
Arabinogalactan peptide 40 |
| Gene Name |
AGP40 |
| NCBI ID |
3702 |
| Cellular Localization |
anchored component of membrane, plasma membrane |
| Processes |
None |
| PubMed |
15322080
|
| Total Prosequence Length (aa) |
27 |
| Prosequence Location |
36:62 |
| Prosequence Sequence |
SASTVAFPVVGSIVAASLSAFLALLLQ |
| Preproprotein Sequence |
MEMKNIFVALFISAVLVSSVSAATMESPAPSPGASSASTVAFPVVGSIVAASLSAFLALLLQ |