Details of PSQ01770
| ProSeqID |
PSQ01770 |
| Family |
FD00002 |
| Protein Name |
Frenatin 3 |
| UniProt ID |
Q571V4
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Hyloidea-Hylidae-Pelodryadinae-Nyctimystes |
| Organisms |
Nyctimystes infrafrenatus (White-lipped tree frog) (Litoria infrafrenata) |
| Prosequence Length (aa) |
24 |
| Functions |
None |
| Preproprotein Length (aa) |
73 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
61195 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, innate immune response |
| PubMed |
15996792
|
| Total Prosequence Length (aa) |
24 |
| Prosequence Location |
23:46 |
| Prosequence Sequence |
EKEKREDQNEEEVDENEEASEEKR |
| Preproprotein Sequence |
MHFLKKSIFLVLFLGLVSLSICEKEKREDQNEEEVDENEEASEEKRGLMSILGKVAGNVLGGLFKPKENVQKM |