Details of PSQ01715
| ProSeqID |
PSQ01715 |
| Family |
FND00120 |
| Protein Name |
Ixosin |
| UniProt ID |
Q2LKX9
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Acari-Parasitiformes-Ixodida-Ixodoidea-Ixodidae-Ixodinae-Ixodes |
| Organisms |
Ixodes sinensis (Hard tick) |
| Prosequence Length (aa) |
56 |
| Functions |
None |
| Preproprotein Length (aa) |
79 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
339422 |
| Cellular Localization |
None |
| Processes |
defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism |
| PubMed |
16087274
|
| Total Prosequence Length (aa) |
56 |
| Prosequence Location |
1:56 |
| Prosequence Sequence |
MSAHKVQIGLSSGQFRVALQVPSVRLKGLGSFHTGSIVLPSQGSLREDQISLHNQD |
| Preproprotein Sequence |
MSAHKVQIGLSSGQFRVALQVPSVRLKGLGSFHTGSIVLPSQGSLREDQISLHNQDGLHKVMREVLGYERNSYKKFFLR |