Details of PSQ01567
| ProSeqID |
PSQ01567 |
| Family |
FD00119 |
| Protein Name |
Cyclotide cter-M |
| UniProt ID |
P86899
|
| Taxonomy |
Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Fabids-Fabales-Fabaceae-Papilionoideae-50-Kb-Inversion-Clade-Npaaa-Clade-Indigoferoidmillettioid-Clade-Phaseoleae-Clitoria |
| Organisms |
Clitoria ternatea (Butterfly pea) |
| Prosequence Length (aa) |
74 |
| Functions |
None |
| Preproprotein Length (aa) |
127 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
43366 |
| Cellular Localization |
extracellular region |
| Processes |
defense response, hemolysis in other organism |
| PubMed |
21593408
|
| Total Prosequence Length (aa) |
74 |
| Prosequence Location |
54:127 |
| Prosequence Sequence |
HIIAANAKTVNEHRLLCTSHEDCFKKGTGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKDDLKMPLESTN |
| Preproprotein Sequence |
MAYVRLTSLAVLFFLAASVMKTEGGLPTCGETCTLGTCYVPDCSCSWPICMKNHIIAANAKTVNEHRLLCTSHEDCFKKGTGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKDDLKMPLESTN |