Details of PSQ01479
| ProSeqID |
PSQ01479 |
| Family |
FND00014 |
| Protein Name |
Aurein-2 |
| UniProt ID |
P82389
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Hyloidea-Hylidae-Pelodryadinae-Ranoidea |
| Organisms |
Ranoidea aurea (Green and golden bell frog) (Litoria aurea) |
| Prosequence Length (aa) |
27 |
| Functions |
None |
| Preproprotein Length (aa) |
72 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
8371 |
| Cellular Localization |
extracellular region, membrane, other organism cell membrane |
| Processes |
defense response to bacterium, innate immune response |
| PubMed |
10951191
|
| Total Prosequence Length (aa) |
27 |
| Prosequence Location |
23:49 |
| Prosequence Sequence |
EKEKRQNEEDEDENEAANHEEGSEEKR |
| Preproprotein Sequence |
MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGALGSLGKRNDLE |