Details of PSQ01292
| ProSeqID |
PSQ01292 |
| Family |
FD00397 |
| Protein Name |
Platelet basic protein |
| UniProt ID |
P43030
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Suina-Suidae-Sus |
| Organisms |
Sus scrofa (Pig) |
| Prosequence Length (aa) |
6 |
| Functions |
chemokine activity, CXCR chemokine receptor binding, growth factor activity |
| Preproprotein Length (aa) |
120 |
| Alt Name |
C-X-C motif chemokine 7, Small-inducible cytokine B7 |
| Gene Name |
PPBP |
| NCBI ID |
9823 |
| Cellular Localization |
extracellular space |
| Processes |
antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, chemokine-mediated signaling pathway, inflammatory response, neutrophil chemotaxis, positive regulation of cell division |
| PubMed |
7513641
|
| Total Prosequence Length (aa) |
6 |
| Prosequence Location |
34:39 |
| Prosequence Sequence |
VPATMG |
| Preproprotein Sequence |
MSLRLGAISSCTTSSPFPVLQVLLPLSLLLTTLVPATMGAAKIEGRMAHVELRCLCLNTVSGIHPSNIQSLEVIRAGAHCAKVEVIATLKNDKKICLDPEAPRIKKIVQKIMEDGGSAA |