Details of PSQ01235
| ProSeqID |
PSQ01235 |
| Family |
FD00176 |
| Protein Name |
M-factor |
| UniProt ID |
P34069
|
| Taxonomy |
Eukaryota-Fungi-Dikarya-Ascomycota-Taphrinomycotina-Schizosaccharomycetes-Schizosaccharomycetales-Schizosaccharomycetaceae-Schizosaccharomyces |
| Organisms |
Schizosaccharomyces pombe (strain 972 |
| Prosequence Length (aa) |
32 |
| Functions |
mating pheromone activity |
| Preproprotein Length (aa) |
44 |
| Alt Name |
None |
| Gene Name |
mfm2 |
| NCBI ID |
284812 |
| Cellular Localization |
cytosol, extracellular region, nucleus, plasma membrane |
| Processes |
cell-cell signaling, positive regulation of pheromone response MAPK cascade, regulation of cell cycle switching, mitotic to meiotic cell cycle, signal transduction involved in positive regulation of conjugation with cellular fusion |
| PubMed |
1547790
|
| Total Prosequence Length (aa) |
32 |
| Prosequence Location |
1:32 |
| Prosequence Sequence |
MDSIATNTHSSSIVNAYNNNPTDVVKTQNIKN |
| Preproprotein Sequence |
MDSIATNTHSSSIVNAYNNNPTDVVKTQNIKNYTPKVPYMCVIA |