Details of PSQ01199
| ProSeqID |
PSQ01199 |
| Family |
FD00074 |
| Protein Name |
Bacteriocin pediocin PA-1 |
| UniProt ID |
P29430
|
| Taxonomy |
Bacteria-Firmicutes-Bacilli-Lactobacillales-Lactobacillaceae-Pediococcus-Pediococcus-Acidilactici-Group |
| Organisms |
Pediococcus acidilactici |
| Prosequence Length (aa) |
18 |
| Functions |
None |
| Preproprotein Length (aa) |
62 |
| Alt Name |
Pediocin ACH |
| Gene Name |
pedA |
| NCBI ID |
1254 |
| Cellular Localization |
extracellular region |
| Processes |
cytolysis, defense response to bacterium |
| PubMed |
1402795,
1575516
|
| Total Prosequence Length (aa) |
18 |
| Prosequence Location |
1:18 |
| Prosequence Sequence |
MKKIEKLTEKEMANIIGG |
| Preproprotein Sequence |
MKKIEKLTEKEMANIIGGKYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC |