Details of PSQ01181
| ProSeqID |
PSQ01181 |
| Family |
FD00068 |
| Protein Name |
Proteasome subunit beta type-9 |
| UniProt ID |
P28077
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
20 |
| Functions |
endopeptidase activity, proteasome binding, threonine-type endopeptidase activity |
| Preproprotein Length (aa) |
219 |
| Alt Name |
Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, Proteasome chain 7, Proteasome subunit beta-1i, Really interesting new gene 12 protein |
| Gene Name |
Psmb9 |
| NCBI ID |
10116 |
| Cellular Localization |
cytoplasm, cytosol, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex, spermatoproteasome complex |
| Processes |
antigen processing and presentation, cellular response to electrical stimulus, cellular response to interleukin-1, cellular response to virus, liver development, muscle atrophy, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, regulation of cysteine-type endopeptidase activity, response to alkaloid, response to bacterium, response to benzene, response to drug, spleen development, thymus development |
| PubMed |
2335214
|
| Total Prosequence Length (aa) |
20 |
| Prosequence Location |
1:20 |
| Prosequence Sequence |
MLQAGAPTAGSFRTGEVHTG |
| Preproprotein Sequence |
MLQAGAPTAGSFRTGEVHTGTTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGTMGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTITADGVDHRVILGDELPKFYDE |
