Details of PSQ01112
| ProSeqID |
PSQ01112 |
| Family |
FD00184 |
| Protein Name |
Elafin |
| UniProt ID |
P19957
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
38 |
| Functions |
endopeptidase inhibitor activity, serine-type endopeptidase inhibitor activity, structural constituent of skin epidermis |
| Preproprotein Length (aa) |
120 |
| Alt Name |
Elastase-specific inhibitor, Peptidase inhibitor 3, Protease inhibitor WAP3, Skin-derived antileukoproteinase, WAP four-disulfide core domain protein 14 |
| Gene Name |
PI3 |
| NCBI ID |
9606 |
| Cellular Localization |
cornified envelope, cytosol, extracellular matrix, extracellular region, extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral response, copulation, cornification, innate immune response, peptide cross-linking |
| PubMed |
1536690,
2394696
|
| Total Prosequence Length (aa) |
38 |
| Prosequence Location |
23:60 |
| Prosequence Sequence |
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK |
| Preproprotein Sequence |
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQn/ |