Details of PSQ01021
| ProSeqID |
PSQ01021 |
| Family |
FD00019 |
| Protein Name |
U1-theraphotoxin-Tal1a |
| UniProt ID |
P0DUC0
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Brachypelma |
| Organisms |
Tliltocatl albopilosus (Curlyhair tarantula) (Brachypelma albopilosum) |
| Prosequence Length (aa) |
35 |
| Functions |
sodium channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
99 |
| Alt Name |
Brachyin |
| Gene Name |
None |
| NCBI ID |
351119 |
| Cellular Localization |
extracellular region |
| Processes |
None |
| PubMed |
25329070
|
| Total Prosequence Length (aa) |
35 |
| Prosequence Location |
23:57 |
| Prosequence Sequence |
DEDSAETSLLRKLKEAEASLFGQHLEESQHSREKR |
| Preproprotein Sequence |
MNTIQVIIFAVVLVLTVTVGQADEDSAETSLLRKLKEAEASLFGQHLEESQHSREKRCLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRSG |