Details of PSQ00948
| ProSeqID |
PSQ00948 |
| Family |
FND00233 |
| Protein Name |
Orally active insecticidal peptide |
| UniProt ID |
P0DM66
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Selenotypus |
| Organisms |
Selenotypus plumipes (Australian featherleg tarantula) |
| Prosequence Length (aa) |
25 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
79 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
1395661 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
23894279
|
| Total Prosequence Length (aa) |
25 |
| Prosequence Location |
20:44 |
| Prosequence Sequence |
SEMKERSSFNEVLSEFFAADEPQER |
| Preproprotein Sequence |
MRVLFIIAGLALLSVVCYTSEMKERSSFNEVLSEFFAADEPQERDCLGQWASCEPKNSKCCPNYACTWKYPWCRYRAGK |