Details of PSQ00851
| ProSeqID |
PSQ00851 |
| Family |
FND00023 |
| Protein Name |
Conotoxin Tx3 |
| UniProt ID |
P0C1N7
|
| Taxonomy |
Eukaryota-Metazoa-Spiralia-Lophotrochozoa-Mollusca-Gastropoda-Caenogastropoda-Neogastropoda-Conoidea-Conidae-Conus-Cylinder |
| Organisms |
Conus textile (Cloth-of-gold cone) |
| Prosequence Length (aa) |
28 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
64 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
6494 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
19380747
|
| Total Prosequence Length (aa) |
28 |
| Prosequence Location |
20:47 |
| Prosequence Sequence |
LPLDGDQPADQAAERMQAEQHPLFDQKR |
| Preproprotein Sequence |
MSKLGVLLTICLLLFPLTALPLDGDQPADQAAERMQAEQHPLFDQKRRCCKFPCPDSCRYLCCG |