Details of PSQ00834
| ProSeqID |
PSQ00834 |
| Family |
FD00083 |
| Protein Name |
Pro-cathepsin H |
| UniProt ID |
P09668
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
75 |
| Functions |
aminopeptidase activity, cysteine-type endopeptidase activator activity involved in apoptotic process, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, HLA-A specific activating MHC class I receptor activity, peptidase activity, serine-type endopeptidase activity, thyroid hormone binding |
| Preproprotein Length (aa) |
335 |
| Alt Name |
None |
| Gene Name |
CTSH |
| NCBI ID |
9606 |
| Cellular Localization |
alveolar lamellar body, collagen-containing extracellular matrix, cytoplasmic ribonucleoprotein granule, cytosol, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular membrane-bounded organelle, lysosome, multivesicular body lumen, secretory granule lumen, tertiary granule lumen |
| Processes |
adaptive immune response, antigen processing and presentation, bradykinin catabolic process, cellular protein metabolic process, cellular response to thyroid hormone stimulus, dichotomous subdivision of terminal units involved in lung branching, ERK1 and ERK2 cascade, immune response-regulating signaling pathway, membrane protein proteolysis, metanephros development, negative regulation of apoptotic process, neuropeptide catabolic process, neutrophil degranulation, positive regulation of angiogenesis, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epithelial cell migration, positive regulation of gene expression, positive regulation of peptidase activity, protein destabilization, proteolysis, proteolysis involved in cellular protein catabolic process, response to retinoic acid, surfactant homeostasis, T cell mediated cytotoxicity, zymogen activation |
| PubMed |
3342889
|
| Total Prosequence Length (aa) |
75 |
| Prosequence Location |
23:97 |
| Prosequence Sequence |
AELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWS |
| Preproprotein Sequence |
MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV |