Details of PSQ00798
| ProSeqID |
PSQ00798 |
| Family |
FD00115 |
| Protein Name |
Corticostatin 1 |
| UniProt ID |
P07469
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Lagomorpha-Leporidae-Oryctolagus |
| Organisms |
Oryctolagus cuniculus (Rabbit) |
| Prosequence Length (aa) |
40 |
| Functions |
None |
| Preproprotein Length (aa) |
93 |
| Alt Name |
Antiadrenocorticotropin peptide I, Corticostatin I, Microbicidal peptide NP-3A, Neutrophil antibiotic peptide NP-3A |
| Gene Name |
None |
| NCBI ID |
9986 |
| Cellular Localization |
extracellular space |
| Processes |
defense response to bacterium |
| PubMed |
1311240,
2829194,
3988726
|
| Total Prosequence Length (aa) |
40 |
| Prosequence Location |
20:59 |
| Prosequence Sequence |
ELFSVNVDEVLDQQQPGSDQDLVIHLTGEESSALQVPDTK |
| Preproprotein Sequence |
MRTLILLAAILLAALQAQAELFSVNVDEVLDQQQPGSDQDLVIHLTGEESSALQVPDTKGICACRRRFCPNSERFSGYCRVNGARYVRCCSRR |