Details of PSQ00584
| ProSeqID |
PSQ00584 |
| Family |
FND00257 |
| Protein Name |
Senegalin |
| UniProt ID |
L0P323
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Microhyloidea-Hyperoliidae-Kassina |
| Organisms |
Kassina senegalensis (Senegal running frog) |
| Prosequence Length (aa) |
33 |
| Functions |
None |
| Preproprotein Length (aa) |
76 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
8415 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, killing of cells of other organism |
| PubMed |
23430307
|
| Total Prosequence Length (aa) |
33 |
| Prosequence Location |
23:55 |
| Prosequence Sequence |
NKRSDGKRADEEGEDKRADEEGEDKRADEEGED |
| Preproprotein Sequence |
MLSLKKSMLLLFFLGMVSFSLANKRSDGKRADEEGEDKRADEEGEDKRADEEGEDKRKRFLPFLIPALTSLISSLG |