Details of PSQ00534
| ProSeqID |
PSQ00534 |
| Family |
FD00002 |
| Protein Name |
Kasstasin |
| UniProt ID |
G0LWV9
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Microhyloidea-Hyperoliidae-Kassina |
| Organisms |
Phlyctimantis maculatus (Red-legged running frog) (Hylambates maculatus) |
| Prosequence Length (aa) |
24 |
| Functions |
None |
| Preproprotein Length (aa) |
68 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
2517390 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, hemolysis in other organism, vasoconstriction |
| PubMed |
21624426
|
| Total Prosequence Length (aa) |
24 |
| Prosequence Location |
21:44 |
| Prosequence Sequence |
DDKREDEGEEKRADEGEEKRAAEE |
| Preproprotein Sequence |
MMKKSMLLLFFLGMVSFSLADDKREDEGEEKRADEGEEKRAAEEKRFIKELLPHLSGIIDSVANAIKG |