Details of PSQ00492
| ProSeqID |
PSQ00492 |
| Family |
FD00002 |
| Protein Name |
Brevinin-1SN2 |
| UniProt ID |
E7EKH2
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Sylvirana |
| Organisms |
Sylvirana spinulosa (Fine-spined frog) (Hylarana spinulosa) |
| Prosequence Length (aa) |
23 |
| Functions |
None |
| Preproprotein Length (aa) |
71 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
369515 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism |
| PubMed |
24055160
|
| Total Prosequence Length (aa) |
23 |
| Prosequence Location |
23:45 |
| Prosequence Sequence |
EEERNADEDEKRDGDDESDVEVQ |
| Preproprotein Sequence |
MFTMKKSLLLIFFLGTINLSLCEEERNADEDEKRDGDDESDVEVQKRFMGTALKIAANVLPAAFCKIFKKC |