Details of PSQ00460
| ProSeqID |
PSQ00460 |
| Family |
FND00290 |
| Protein Name |
Jingdongin-1-MT1 |
| UniProt ID |
E1B245
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops |
| Organisms |
Amolops mantzorum (Sichuan torrent frog) |
| Prosequence Length (aa) |
22 |
| Functions |
None |
| Preproprotein Length (aa) |
63 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
167930 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, hemolysis in other organism |
| PubMed |
24601776
|
| Total Prosequence Length (aa) |
22 |
| Prosequence Location |
23:44 |
| Prosequence Sequence |
EQERDADEEERRDDDEMDVEVE |
| Preproprotein Sequence |
MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDDEMDVEVEKRFLPLFLPKIICAITKKC |