Details of PSQ00334
| ProSeqID |
PSQ00334 |
| Family |
FD00001 |
| Protein Name |
Hainantoxin-III 2 |
| UniProt ID |
D2Y1Y0
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Haplopelma |
| Organisms |
Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
| Prosequence Length (aa) |
27 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
83 |
| Alt Name |
Hainantoxin-3, Mu-theraphotoxin-Hhn2a, Peptide F7-18 |
| Gene Name |
None |
| NCBI ID |
209901 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
14512091,
20192277
|
| Total Prosequence Length (aa) |
27 |
| Prosequence Location |
22:48 |
| Prosequence Sequence |
SESEEKEFPRELLSKIFAVDDFKGEER |
| Preproprotein Sequence |
MKASMYLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPGKNECCPNYACSSKHKWCKVYLGK |