Details of PSQ00316
| ProSeqID |
PSQ00316 |
| Family |
FND00001 |
| Protein Name |
Temporin-ALk |
| UniProt ID |
C5H0E2
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops |
| Organisms |
Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis) |
| Prosequence Length (aa) |
24 |
| Functions |
None |
| Preproprotein Length (aa) |
60 |
| Alt Name |
Amolopin-n1 |
| Gene Name |
None |
| NCBI ID |
318551 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism |
| PubMed |
19843479
|
| Total Prosequence Length (aa) |
24 |
| Prosequence Location |
23:46 |
| Prosequence Sequence |
EQERNAEEERRDDLGERQAEVEKR |
| Preproprotein Sequence |
MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKRFFPIVGKLLSG |