Details of PSQ00275
| ProSeqID |
PSQ00275 |
| Family |
FND00342 |
| Protein Name |
Cytoinsectotoxin-4 |
| UniProt ID |
C0HJV6
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Araneomorphae-Entelegynae-Entelegynae-Incertae-Sedis-Zodariidae-Lachesana |
| Organisms |
Lachesana tarabaevi (Spider) |
| Prosequence Length (aa) |
43 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
124 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
379576 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium |
| PubMed |
27287558
|
| Total Prosequence Length (aa) |
43 |
| Prosequence Location |
20:62 |
| Prosequence Sequence |
SEPAETENEDLDDLSDLEDEEWLDELEEAAEYLESLREFEESR |
| Preproprotein Sequence |
MKCFILAAALVLAFACIAASEPAETENEDLDDLSDLEDEEWLDELEEAAEYLESLREFEESRGYKDYMSKAKDLYKDIKKDKRVKAVMKSSYMKEAKKLYKDNPVRDAYQVYKGVKAGGKLLFG |