Details of PSQ00202
| ProSeqID |
PSQ00202 |
| Family |
FD00001 |
| Protein Name |
Mu-theraphotoxin-Cg1a |
| UniProt ID |
B1P1F7
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Chilobrachys |
| Organisms |
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) |
| Prosequence Length (aa) |
29 |
| Functions |
ion channel inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
87 |
| Alt Name |
Jingzhaotoxin-34 , Peptide F6-25 |
| Gene Name |
None |
| NCBI ID |
278060 |
| Cellular Localization |
extracellular region |
| Processes |
pathogenesis |
| PubMed |
17476710
|
| Total Prosequence Length (aa) |
29 |
| Prosequence Location |
22:50 |
| Prosequence Sequence |
AELEERGSDQRDSPAWVKSMERIFQSEER |
| Preproprotein Sequence |
MKVLVLITLAVLGAMFVWTSAAELEERGSDQRDSPAWVKSMERIFQSEERACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTVRK |